4Y5O: CCM2 HHD

CCM2 HHD in complex with MEKK3 NPB1. Determined by X-ray diffraction at 2.35 Å resolution. Released 1 Jul 2015.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,471
Mol. weight: 25.84 kDa
Released: 1 Jul 2015

Explore 4Y5O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4Y5O contains 14 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	296-309	14
α-helix	312-326	15
α-helix	331-341	11
α-helix	344-346	3
α-helix	347-353	7
α-helix	354-356	3
α-helix	359-367	9

Chain B: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	1-14	14
α-helix	44	1
β-strand	45-51	7	1
β-strand	54-60	7	1
α-helix	61	1
α-helix	64-65	2
α-helix	66-77	12
β-strand	82-85	4	1
α-helix	88-90	3
β-strand	92-93	2	1
α-helix	97-109	13
β-strand	116-121	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Malcavernin	A	protein	98	Homo sapiens	Q9BSQ5 (AlphaFold model)
Mitogen-activated protein kinase kinase kinase 3	B	protein	126	Homo sapiens	Q99759 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4Y5O_1 Malcavernin (chains A)
GSKTISESELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQL
YGDSRKFLLLGLRPFIPEKDSQHFENFLETIGVKDGRG

Sequence of entity 2 (B), FASTA

>4Y5O_2 Mitogen-activated protein kinase kinase kinase 3 (chains B)
GSMDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRII
AFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRI
LLLSQD

Primary citation

Structure and vascular function of MEKK3-cerebral cavernous malformations 2 complex. Fisher, O.S., Deng, H., Liu, D. et al. Nat Commun (2015) 6:7937-7937. DOI 10.1038/ncomms8937 · PubMed

Other PDB entries of the same protein (UniProt Q9BSQ5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FQN 1.9 Å, Crystal structure of the CCM2 C-terminal Harmonin Homology Domain (HHD)
4YKD 1.93 Å, Crystal structure of truncated cerebral cavernous malformation 2 C-terminal adaptor domain
4YL6 2.1 Å, Crystal structure of truncated cerebral cavernous malformation 2 C-terminal adaptor…
4YKC 2.7 Å, Crystal structure of cerebral cavernous malformation 2 C-terminal adaptor domain
4WJ7 2.75 Å, CCM2 PTB domain in complex with KRIT1 NPxY/F3
4TVQ 2.8 Å, CCM3 in complex with CCM2 LD-like motif
9PVG 3.0 Å, Co-crystal structure of two CCM2 PTB domains bound to a KRIT1 peptide encompassing NPxF2…

Browse structure collections

About this viewer

MolViewer shows 4Y5O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.