4YAY: XFEL structure of human Angiotensin Receptor

XFEL structure of human Angiotensin Receptor. Determined by X-ray diffraction at 2.9 Å resolution. Released 22 Apr 2015.

Method: X-ray diffraction
Resolution: 2.9 Å
Organisms: Escherichia coli, Homo sapiens
Chains: 1
Atoms: 3,110
Mol. weight: 47.68 kDa
Ligands: ZD7
Released: 22 Apr 2015

Explore 4YAY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4YAY contains 20 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1003-1019	17
α-helix	1023-1041	19
α-helix	1056-1081	26
α-helix	1085-1091	7
α-helix	1094-1101	8
α-helix	1102-1106	5
β-strand	12	1	1
α-helix	27-52	26
α-helix	53-57	5
α-helix	62-89	28
α-helix	99-130	32
α-helix	138-159	22
α-helix	161-166	6
β-strand	167-170	4	2
β-strand	171	1	1
β-strand	179-182	4	2
α-helix	183-184	2
α-helix	193-203	11
α-helix	205-220	16
α-helix	236-268	33
α-helix	274-290	17
α-helix	294-297	4
α-helix	298-304	7
α-helix	306-316	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Soluble cytochrome b562,Type-1 angiotensin II receptor	A	protein	414	Escherichia coli, Homo sapiens	P0ABE7 (AlphaFold model), P30556 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4YAY_1 Soluble cytochrome b562,Type-1 angiotensin II receptor (chains A)
ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKD
FRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLILNSSDCPKAGRHN
YIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWA
VYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVA
KVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFL
FPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVL
IQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKY

Ligands and cofactors

ID	Name	Formula	Copies
ZD7	5,7-diethyl-1-{[2'-(1H-tetrazol-5-yl)biphenyl-4-yl]methyl}-3,4-dihydro-1,6-naph…	C26 H26 N6 O	1

Primary citation

Structure of the Angiotensin receptor revealed by serial femtosecond crystallography. Zhang, H., Unal, H., Gati, C. et al. Cell (2015) 161:833-844. DOI 10.1016/j.cell.2015.04.011 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 4YAY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.