Crystal structure of the Crumbs/Moesin complex. Determined by X-ray diffraction at 1.5 Å resolution. Released 1 Apr 2015.
Explore 4YL8 in 3D Show helices and sheets RCSB PDB PDBe
4YL8 contains 14 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-10 | 6 | 1 |
| β-strand | 15-20 | 6 | 1 |
| β-strand | 25 | 1 | 2 |
| α-helix | 26-37 | 12 | |
| α-helix | 42-44 | 3 | |
| β-strand | 45-50 | 6 | 1 |
| β-strand | 51 | 1 | 3 |
| β-strand | 56-58 | 3 | 1 |
| α-helix | 59-60 | 2 | |
| β-strand | 64 | 1 | 2 |
| α-helix | 65-67 | 3 | |
| β-strand | 70 | 1 | 3 |
| β-strand | 76-82 | 7 | 1 |
| α-helix | 89-92 | 4 | |
| α-helix | 96-111 | 16 | |
| α-helix | 119-134 | 16 | |
| α-helix | 155-160 | 6 | |
| α-helix | 165-178 | 14 | |
| α-helix | 184-195 | 12 | |
| β-strand | 204-209 | 6 | 4 |
| β-strand | 215-221 | 7 | 4 |
| β-strand | 224-229 | 6 | 4 |
| β-strand | 238-241 | 4 | 4 |
| α-helix | 242-244 | 3 | |
| β-strand | 245-251 | 7 | 4 |
| β-strand | 254-259 | 6 | 4 |
| α-helix | 265-266 | 2 | |
| β-strand | 267-270 | 4 | 4 |
| α-helix | 274-294 | 21 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2109-2110 | 2 | 4 |
| β-strand | 2116-2119 | 4 | 4 |
| α-helix | 2137-2143 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Moesin | A | protein | 303 | Mus musculus | P26041 (AlphaFold model) |
| Protein crumbs | B | protein | 43 | Drosophila melanogaster | P10040 (AlphaFold model) |
>4YL8_1 Moesin (chains A) GPGSEFMPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKA FSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDD IYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQV WHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRL TPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRR RKP
>4YL8_2 Protein crumbs (chains B) GPGSEFRNKRATRGTYSPSAQEYCNPRLEMDNVLKPPPEERLI
Structural Basis for the Phosphorylation-regulated Interaction between the Cytoplasmic Tail of Cell Polarity Protein Crumbs and the Actin-binding Protein Moesin. Wei, Z., Li, Y., Ye, F. et al. J Biol Chem (2015) 290:11384-11392. DOI 10.1074/jbc.M115.643791 · PubMed
MolViewer shows 4YL8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.