ASH1L wild-type SET domain in complex with S-adenosyl methionine (SAM). Determined by X-ray diffraction at 2.19 Å resolution. Released 2 Sept 2015.
Explore 4YNM in 3D Show helices and sheets RCSB PDB PDBe
4YNM contains 21 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2070-2071 | 2 | 1 |
| α-helix | 2075 | 1 | |
| β-strand | 2076-2077 | 2 | 2 |
| β-strand | 2083 | 1 | 3 |
| β-strand | 2103 | 1 | 4 |
| α-helix | 2109-2112 | 4 | |
| β-strand | 2115 | 1 | 3 |
| α-helix | 2116-2118 | 3 | |
| α-helix | 2125-2127 | 3 | |
| β-strand | 2128 | 1 | 4 |
| β-strand | 2142-2146 | 5 | 5 |
| β-strand | 2152-2156 | 5 | 5 |
| β-strand | 2160 | 1 | 6 |
| β-strand | 2165-2168 | 4 | 3 |
| β-strand | 2172-2175 | 4 | 2 |
| α-helix | 2176-2185 | 10 | |
| β-strand | 2195-2199 | 5 | 2 |
| β-strand | 2202-2205 | 4 | 2 |
| β-strand | 2209-2210 | 2 | 1 |
| α-helix | 2212-2215 | 4 | |
| α-helix | 2216 | 1 | |
| β-strand | 2217-2218 | 2 | 7 |
| β-strand | 2224-2231 | 8 | 3 |
| β-strand | 2234-2241 | 8 | 3 |
| β-strand | 2245 | 1 | 6 |
| α-helix | 2249 | 1 | |
| β-strand | 2250 | 1 | 5 |
| α-helix | 2251 | 1 | |
| β-strand | 2252-2253 | 2 | 7 |
| α-helix | 2255-2258 | 4 | |
| β-strand | 2259 | 1 | 2 |
| β-strand | 2266-2267 | 2 | 8 |
| β-strand | 2278-2279 | 2 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2070-2071 | 2 | 9 |
| α-helix | 2075 | 1 | |
| β-strand | 2076-2077 | 2 | 10 |
| β-strand | 2083 | 1 | 11 |
| α-helix | 2111-2113 | 3 | |
| β-strand | 2115 | 1 | 11 |
| α-helix | 2116-2118 | 3 | |
| α-helix | 2125-2127 | 3 | |
| β-strand | 2142-2146 | 5 | 12 |
| β-strand | 2152-2156 | 5 | 12 |
| β-strand | 2160 | 1 | 13 |
| β-strand | 2165-2168 | 4 | 11 |
| β-strand | 2172-2175 | 4 | 10 |
| α-helix | 2176-2182 | 7 | |
| α-helix | 2183-2187 | 5 | |
| β-strand | 2195-2197 | 3 | 10 |
| β-strand | 2202-2205 | 4 | 10 |
| β-strand | 2209-2210 | 2 | 9 |
| α-helix | 2212-2215 | 4 | |
| α-helix | 2216 | 1 | |
| β-strand | 2217-2218 | 2 | 14 |
| β-strand | 2224-2231 | 8 | 11 |
| β-strand | 2234-2241 | 8 | 11 |
| β-strand | 2245 | 1 | 13 |
| α-helix | 2249 | 1 | |
| β-strand | 2250 | 1 | 12 |
| α-helix | 2251 | 1 | |
| β-strand | 2252-2253 | 2 | 14 |
| α-helix | 2255-2258 | 4 | |
| β-strand | 2259 | 1 | 10 |
| β-strand | 2267 | 1 | 15 |
| β-strand | 2278 | 1 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone-lysine N-methyltransferase ASH1L | A, B | protein | 226 | Homo sapiens | Q9NR48 |
>4YNM_1 Histone-lysine N-methyltransferase ASH1L (chains A, B) GAMAGSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTC PCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNR MIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYAL KDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIGGKSQRVNG
Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase. Rogawski, D.S., Ndoj, J., Cho, H.J. et al. Biochemistry (2015) 54:5401-5413. DOI 10.1021/acs.biochem.5b00697 · PubMed
Other PDB entries of the same protein (UniProt Q9NR48), best resolution first:
MolViewer shows 4YNM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.