4YOZ: P107 pocket domain

p107 pocket domain in complex with HPV E7 peptide. Determined by X-ray diffraction at 2.25 Å resolution. Released 24 Jun 2015.

Method: X-ray diffraction
Resolution: 2.25 Å
Organisms: Homo sapiens, Human papillomavirus
Chains: 2
Atoms: 3,012
Mol. weight: 44.81 kDa
Released: 24 Jun 2015

Explore 4YOZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4YOZ contains 26 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	392-400	9
α-helix	410-417	8
α-helix	424-442	19
α-helix	454-477	24
α-helix	480-483	4
α-helix	489-492	4
α-helix	495-512	18
α-helix	521-525	5
α-helix	530-533	4
α-helix	535-543	9
α-helix	549-564	16
α-helix	566-568	3
α-helix	573-580	8
α-helix	585-587	3
α-helix	588-591	4
α-helix	781-782	2
α-helix	785-809	25
α-helix	814-830	17
α-helix	832-835	4
α-helix	840-854	15
α-helix	861-868	8
α-helix	876-880	5
β-strand	882-883	2	1
β-strand	927-928	2	1
α-helix	930-933	4
α-helix	934-938	5
α-helix	939-946	8
α-helix	964-966	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinoblastoma-like protein 1,Retinoblastoma-like protein 1	A	protein	371	Homo sapiens	P28749 (AlphaFold model)
HPV E7 peptide	B	protein	9	Human papillomavirus	P03129 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4YOZ_1 Retinoblastoma-like protein 1,Retinoblastoma-like protein 1 (chains A)
GEFTQSVSRLQSIVAGLKNAPSDQLINIFESCVRNPVENIMKILKGIGETFCQHYTQSTD
EQPGSHIDFAVNRLKLAEILYYKILETVMVQETRRLHGMDMSVLLEQDIFHRSLMACCLE
IVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVVIRSEEGLSRDMVKHLNSIEEQILESLA
WSHDSALWEALQVSANKVPTCEEVIFPNNFETGNNRPKRTGSLALFYRKVYHLASVRLRD
LCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHLDQLLLCAFYIMAKVTKEERTFQEIM
KSYRNQPQANSHVYRSVLLKSIKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDAP
PLSPFPHIKQQ

Sequence of entity 2 (B), FASTA

>4YOZ_2 HPV E7 peptide (chains B)
DLYCYEQLN

Primary citation

Structural mechanisms of DREAM complex assembly and regulation. Guiley, K.Z., Liban, T.J., Felthousen, J.G. et al. Genes Dev (2015) 29:961-974. DOI 10.1101/gad.257568.114 · PubMed

Other PDB entries of the same protein (UniProt P28749 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SMD 2.15 Å, p107 pocket domain complexed with EID1 peptide
4YOS 2.3 Å, p107 pocket domain complexed with LIN52 peptide
4YOO 2.4 Å, p107 pocket domain in complex with LIN52 P29A peptide
9C6B 2.6 Å, PP2A:B55-p107 substrate complex
7SME 2.64 Å, p107 pocket domain complexed with HDAC1 peptide
7SMC 2.7 Å, p107 pocket domain complexed with ARID4A peptide
1H28 2.8 Å, CDK2/CyclinA in complex with an 11-residue recruitment peptide from p107
5TUV 2.9 Å, Crystal structure of the E2F5-DP1-p107 ternary complex
7SMF 3.0 Å, p107 pocket domain complexed with mutated HDAC1-3X peptide

Browse structure collections

About this viewer

MolViewer shows 4YOZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.