Crystal structure of BRD9 Bromodomain bound to a crotonyllysine peptide. Determined by X-ray diffraction at 1.52 Å resolution. Released 16 Sept 2015.
Explore 4YYD in 3D Show helices and sheets RCSB PDB PDBe
4YYD contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 26-38 | 13 | |
| α-helix | 48-50 | 3 | |
| α-helix | 57-60 | 4 | |
| α-helix | 67-75 | 9 | |
| α-helix | 82-99 | 18 | |
| α-helix | 105-121 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bromodomain-containing protein 9 | A | protein | 108 | Homo sapiens | Q9H8M2 (AlphaFold model) |
| Histone H4 | Z | protein | 11 | Homo sapiens | P62805 (AlphaFold model) |
>4YYD_1 Bromodomain-containing protein 9 (chains A) GSAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIV ANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK
>4YYD_2 Histone H4 (chains Z) SGRGXGGXGLG
A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications. Flynn, E.M., Huang, O.W., Poy, F. et al. Structure (2015) 23:1801-1814. DOI 10.1016/j.str.2015.08.004 · PubMed
Other PDB entries of the same protein (UniProt Q9H8M2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4YYD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.