4YYI: BRD9 Bromodomain

Crystal structure of BRD9 Bromodomain bound to an acetylated peptide. Determined by X-ray diffraction at 1.5 Å resolution. Released 16 Sept 2015.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 6
Atoms: 3,639
Mol. weight: 51.89 kDa
Released: 16 Sept 2015

Explore 4YYI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4YYI contains 20 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and D: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	24-38	15
α-helix	57-60	4
α-helix	67-75	9
α-helix	82-99	18
α-helix	105-120	16

Chains B and E: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	24-37	14
α-helix	57-60	4
α-helix	67-75	9
α-helix	82-99	18
α-helix	105-120	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain-containing protein 9	A, B, D, E	protein	108	Homo sapiens	Q9H8M2 (AlphaFold model)
Histone H4	C, F	protein	11	Homo sapiens	P62805 (AlphaFold model)

Sequence of entity 1 (A, B, D, E), FASTA

>4YYI_1 Bromodomain-containing protein 9 (chains A, B, D, E)
GSAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIV
ANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK

Sequence of entity 2 (C, F), FASTA

>4YYI_2 Histone H4 (chains C, F)
SGRGKGGKGLG

Primary citation

A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications. Flynn, E.M., Huang, O.W., Poy, F. et al. Structure (2015) 23:1801-1814. DOI 10.1016/j.str.2015.08.004 · PubMed

Other PDB entries of the same protein (UniProt Q9H8M2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BQA 1.03 Å, BRD9 bromodomain in complex with 3-(6-(but-3-en-1-yl)-7-oxo-6,7-dihydro-1H-pyrrolo[2,3-c]…
5I40 1.04 Å, BRD9 in complex with Cpd1 (6-methyl-1,6-dihydro-7H-pyrrolo[2,3-c]pyridin-7-one)
9ZU4 1.05 Å, Crystal structure of BRD9 bromodomain bound to BZ2
9ZU3 1.15 Å, Crystal structure of BRD9 bromodomain bound to BZ1
5I7X 1.18 Å, BRD9 in complex with Cpd2 (N,N-dimethyl-3-(6-methyl-7-oxo-6,7-dihydro-1H-pyrrolo[2,3-c]py…
6Y7K 1.2 Å, Structure of the BRD9 bromodomain and compound 27
4UIT 1.3 Å, BROMODOMAIN OF HUMAN BRD9 WITH 7-(3,4-dimethoxyphenyl)-2-(4-…
6V1B 1.35 Å, Crystal structure of the bromodomain of human BRD9 bound to I-BRD9
5JI8 1.42 Å, Crystal structure of the BRD9 bromodomain and hit 1
4YY6 1.45 Å, Crystal structure of BRD9 Bromodomain bound to a butyryllysine peptide
5I7Y 1.45 Å, BRD9 in complex with Cpd4 ((E)-3-(6-(but-2-en-1-yl)-7-oxo-6,7-dihydro-1H-pyrrolo[2,3-c]py…
4YY4 1.47 Å, Crystal structure of BRD9 Bromodomain bound to DMSO

Browse structure collections

About this viewer

MolViewer shows 4YYI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.