Crystal structure of TAF1 BD2 Bromodomain bound to a butyryllysine peptide. Determined by X-ray diffraction at 1.5 Å resolution. Released 16 Sept 2015.
Explore 4YYM in 3D Show helices and sheets RCSB PDB PDBe
4YYM contains 17 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1502-1514 | 13 | |
| α-helix | 1515-1519 | 5 | |
| α-helix | 1526-1529 | 4 | |
| α-helix | 1531-1533 | 3 | |
| α-helix | 1540-1543 | 4 | |
| α-helix | 1550-1558 | 9 | |
| α-helix | 1565-1583 | 19 | |
| α-helix | 1588-1606 | 19 | |
| α-helix | 1608-1630 | 23 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1502-1513 | 12 | |
| α-helix | 1514-1519 | 6 | |
| α-helix | 1526-1528 | 3 | |
| α-helix | 1540-1543 | 4 | |
| α-helix | 1550-1558 | 9 | |
| α-helix | 1565-1583 | 19 | |
| α-helix | 1588-1606 | 19 | |
| α-helix | 1608-1631 | 24 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcription initiation factor TFIID subunit 1 | A, B | protein | 144 | Homo sapiens | P21675 (AlphaFold model) |
| Histone H4 | Z | protein | 11 | Homo sapiens | P62805 (AlphaFold model) |
>4YYM_1 Transcription initiation factor TFIID subunit 1 (chains A, B) GSPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIR KNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQL EKDICTAKEAALEEAELESLDPMT
>4YYM_2 Histone H4 (chains Z) SGRGXGGXGLG
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications. Flynn, E.M., Huang, O.W., Poy, F. et al. Structure (2015) 23:1801-1814. DOI 10.1016/j.str.2015.08.004 · PubMed
Other PDB entries of the same protein (UniProt P21675 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4YYM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.