4YYN: TAF1 BD2 Bromodomain

Crystal structure of TAF1 BD2 Bromodomain bound to a crotonyllysine peptide. Determined by X-ray diffraction at 1.85 Å resolution. Released 16 Sept 2015.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,295
Mol. weight: 34.26 kDa
Released: 16 Sept 2015

Explore 4YYN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4YYN contains 17 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	1502-1513	12
α-helix	1514-1519	6
α-helix	1526-1529	4
α-helix	1540-1543	4
α-helix	1550-1558	9
α-helix	1565-1583	19
α-helix	1588-1606	19
α-helix	1608-1628	21

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	1503-1513	11
α-helix	1514-1519	6
α-helix	1526-1528	3
α-helix	1531-1533	3
α-helix	1540-1543	4
α-helix	1550-1558	9
α-helix	1565-1583	19
α-helix	1588-1606	19
α-helix	1608-1628	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor TFIID subunit 1	A, B	protein	144	Homo sapiens	P21675 (AlphaFold model)
Histone H4	Z	protein	11	Homo sapiens	P62805 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4YYN_1 Transcription initiation factor TFIID subunit 1 (chains A, B)
GSPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIR
KNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQL
EKDICTAKEAALEEAELESLDPMT

Sequence of entity 2 (Z), FASTA

>4YYN_2 Histone H4 (chains Z)
SGRGXGGXGLG

Primary citation

A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications. Flynn, E.M., Huang, O.W., Poy, F. et al. Structure (2015) 23:1801-1814. DOI 10.1016/j.str.2015.08.004 · PubMed

Other PDB entries of the same protein (UniProt P21675 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5I29 1.21 Å, TAF1(2) bound to a pyrrolopyridone compound
7LB1 1.35 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ZS1-585
4YYM 1.5 Å, Crystal structure of TAF1 BD2 Bromodomain bound to a butyryllysine peptide
5I1Q 1.5 Å, Second bromodomain of TAF1 bound to a pyrrolopyridone compound
7K27 1.5 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ATR…
7JJG 1.6 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to ATR kinase…
7K03 1.6 Å, Crystal structure of the tandem bromodomain (BD1 and BD2) of human TAF1 bound to ATR…
7T36 1.65 Å, Crystal structure of the tandem bromodomain (BD1 and BD2) of human TAF1 bound to ZS1-322
7JSP 1.7 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to ATR kinase…
7K3O 1.7 Å, Crystal structure of the unliganded second bromodomain (BD2) of human TAF1
7K42 1.7 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to dioxane
7LB2 1.7 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ZS1-589

Browse structure collections

About this viewer

MolViewer shows 4YYN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.