4Z0X: Antibody HC26AM light chain variable domain

Structure of Hepatitis C Virus Envelope glycoprotein E2 antigenic region 434-446 bound to the broadly neutralizing antibody HC26AM. Determined by X-ray diffraction at 2.0 Å resolution. Released 20 Jul 2016.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Homo sapiens, Hepacivirus C
Chains: 3
Atoms: 1,758
Mol. weight: 25.64 kDa
Released: 20 Jul 2016

Explore 4Z0X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4Z0X contains 6 α-helices and 22 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	9-12	4	2
β-strand	18-23	6	1
α-helix	27-29	3
β-strand	33-37	5	2
β-strand	44-47	4	2
β-strand	48	1	3
β-strand	52	1	3
α-helix	53-54	2
β-strand	61-66	6	1
β-strand	69-74	6	1
α-helix	79-81	3
β-strand	83-91	9	2
β-strand	94-97	4	2
β-strand	101-105	5	2

Chain B: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	9-12	4	4
β-strand	18-22	5	5
β-strand	32-39	8	4
β-strand	45-52	8	4
β-strand	57-60	4	4
α-helix	61	1
β-strand	68-72	5	5
β-strand	79-83	5	5
α-helix	88-90	3
β-strand	92-100	9	4
β-strand	108-109	2	4
β-strand	113-117	5	4

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	436-442	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Antibody HC26AM light chain variable domain	A	protein	105	Homo sapiens
Antibody HC26AM heavy chain variable domain	B	protein	121	Homo sapiens
HCV E2 Antigen (residues 432-446)	C	protein	12	Hepacivirus C	P27958 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4Z0X_1 Antibody HC26AM light chain variable domain (chains A)
YVLTQPPSVSVAPGQTASITCSGDKLGDKYVSWYQQRPGQSPVLVLYQDSKRPSGIPERF
SGSNSGNTATLTISGTQAMDEADYYCQAWDSSALVFGGGTKLTVL

Sequence of entity 2 (B), FASTA

>4Z0X_2 Antibody HC26AM heavy chain variable domain (chains B)
VQPVQSGAEVKKPGSSVKVSCEASGGTHSNYVITWVRQAPGQGLEWMGGFIPDFRTAMYA
QGFQGRVTITADESTSLAYMELTNLRSEDTAVYYCARGPLSRGYYDYWGPGTLVTVSSGS
T

Sequence of entity 3 (C), FASTA

>4Z0X_3 HCV E2 Antigen (residues 432-446) (chains C)
TGWLAGLFYQHK

Primary citation

Affinity maturation of a broadly neutralizing human monoclonal antibody that prevents acute hepatitis C virus infection in mice. Keck, Z.Y., Wang, Y., Lau, P. et al. Hepatology (2016) 64:1922-1933. DOI 10.1002/hep.28850 · PubMed

Other PDB entries of the same protein (UniProt P27958 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BZY 1.6 Å, Structure of the Hepatitis C virus envelope glycoprotein E2 antigenic region 412-423…
5FGB 1.65 Å, Three dimensional structure of broadly neutralizing human anti - Hepatitis C virus (HCV)…
6BQJ 1.69 Å, Crystal structure of hepatis C virus protease (NS3) complexed with tripeptidic acyl…
2XI3 1.7 Å, HCV-H77 NS5B Polymerase Complexed With GTP
4N0Y 1.75 Å, Structure of the Hepatitis C Envelope Glycoprotein E1 antigenic region 314-324 bound to…
2XI2 1.8 Å, HCV-H77 NS5B Apo Polymerase
6UYD 1.9 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2mc3-v1 redesigned core from…
5FGC 1.9 Å, Three dimensional structure of broadly neutralizing human anti - Hepatitis C virus (HCV)…
6BQK 1.97 Å, Crystal structure of hepatis C virus protease (NS3) complexed with tripeptidic acyl…
5EOC 1.98 Å, Crystal structure of Fab C2 in complex with a Cyclic variant of Hepatitis C Virus E2…
2O8M 2.0 Å, Crystal structure of the S139A mutant of Hepatitis C Virus NS3/4A protease
4XVJ 2.0 Å, Structure of the hepatitis C virus envelope glycoprotein E2 antigenic 2 region 412-423…

Browse structure collections

About this viewer

MolViewer shows 4Z0X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.