4Z2N: Human FACT SPT16 middle domain

Crystal structure of human FACT SPT16 middle domain. Determined by X-ray diffraction at 1.92 Å resolution. Released 9 Mar 2016.

Method: X-ray diffraction
Resolution: 1.92 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,446
Mol. weight: 33.37 kDa
Released: 9 Mar 2016

Explore 4Z2N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4Z2N contains 11 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	647-651	5
β-strand	661-668	8	1
β-strand	677-682	6	1
β-strand	686-691	6	1
β-strand	696-700	5	1
α-helix	701-703	3
β-strand	704-710	7	1
β-strand	717-730	14	1
β-strand	733-743	11	1
α-helix	759-790	32
β-strand	797-798	2	1
α-helix	802-804	3
β-strand	806-808	3	2
β-strand	809	1	3
β-strand	815-817	3	2
β-strand	818-819	2	4
β-strand	823-826	4	4
β-strand	833-836	4	4
α-helix	837-839	3
β-strand	840-846	7	5
β-strand	854-861	8	5
α-helix	867-868	2
β-strand	869-875	7	5
α-helix	876-878	3
α-helix	879-888	10
β-strand	893-895	3	5
α-helix	902-911	10
α-helix	913-918	6
α-helix	921-925	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FACT complex subunit SPT16	A	protein	287	Homo sapiens	Q9Y5B9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4Z2N_1 FACT complex subunit SPT16 (chains A)
GIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNN
IKHALFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDL
YAEQMEREMRHKLKTAFKNFIEKVEALTKEELEFEVPFRDLGFNGAPYRSTCLLQPTSSA
LVNATEWPPFVVTLDEVELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIK
EWLNSCDLKYTEGVQSLNWTKIMKTIVDDPEGFFEQGGWSFLEPEGE

Primary citation

Integrated molecular mechanism directing nucleosome reorganization by human FACT. Tsunaka, Y., Fujiwara, Y., Oyama, T. et al. Genes Dev (2016) 30:673-686. DOI 10.1101/gad.274183.115 · PubMed

Other PDB entries of the same protein (UniProt Q9Y5B9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5E5B 1.84 Å, Crystal structure of Human Spt16 N-terminal domain
5UMU 1.9 Å, Crystal structure of the middle double PH domain of human FACT complex subunit SPT16
8I17 1.98 Å, Structural basis for H2A-H2B recognitions by human Spt16
5UMT 2.09 Å, Crystal structure of N-terminal domain of human FACT complex subunit SPT16
5XM2 2.19 Å, Human N-terminal domain of FACT complex subunit SPT16
4Z2M 2.98 Å, Crystal structure of human SPT16 Mid-AID/H3-H4 tetramer FACT Histone complex
9EH2 3.1 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-FACT nucleosome upstream
9RZC 3.66 Å, State 3 MAP 1 SETD2 bound to distal H3 of upstream nucleosome
8YJM 4.15 Å, Structure of human SPT16 MD-CTD and MCM2 HBD chaperoning a histone H3-H4 tetramer and a…
8YJF 4.4 Å, Structure of human SPT16 MD-CTD and MCM2 HBD chaperoning a histone H3-H4 tetramer and an…
9GW2 4.84 Å, State 2 MAP 1 SETD2 bound to proximal H3 of upstream nucleosome
6UPK 4.9 Å, Structure of FACT_subnucleosome complex 1

Browse structure collections

About this viewer

MolViewer shows 4Z2N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.