4Z8M: MAVS-TRAF6 complex

Crystal structure of the MAVS-TRAF6 complex. Determined by X-ray diffraction at 2.95 Å resolution. Released 23 Sept 2015.

Method: X-ray diffraction
Resolution: 2.95 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,535
Mol. weight: 43.66 kDa
Released: 23 Sept 2015

Explore 4Z8M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4Z8M contains 13 α-helices and 23 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	351-357	7	1
α-helix	360-368	9
β-strand	373-376	4	2
α-helix	377-379	3
β-strand	380-381	2	2
β-strand	388-395	8	2
β-strand	406-414	9	2
α-helix	419-421	3
β-strand	428-434	7	1
α-helix	443	1
β-strand	446-452	7	1
α-helix	461-462	2
β-strand	466-478	13	2
α-helix	479-484	6
β-strand	488-489	2	1
β-strand	492-500	9	1

Chain B: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	351-357	7	3
α-helix	360-368	9
β-strand	373-376	4	4
α-helix	377-379	3
β-strand	380-381	2	4
β-strand	388-395	8	4
β-strand	406-414	9	4
α-helix	419-421	3
β-strand	428-434	7	3
α-helix	435-436	2
β-strand	446-452	7	3
α-helix	457-459	3
α-helix	461-462	2
β-strand	466	1	4
β-strand	469-478	10	4
α-helix	479-484	6
β-strand	488	1	3
β-strand	493-500	8	3

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	604-607	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TNF receptor-associated factor 6	A, B	protein	169	Homo sapiens	Q9Y4K3 (AlphaFold model)
Peptide from Mitochondrial antiviral-signaling protein	C, D	protein	19	Homo sapiens	Q7Z434 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4Z8M_1 TNF receptor-associated factor 6 (chains A, B)
MAAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRC
ANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPT
IPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDLEHHHHHH

Sequence of entity 2 (C, D), FASTA

>4Z8M_2 Peptide from Mitochondrial antiviral-signaling protein (chains C, D)
GPCHGPEENEYKSEGTFGI

Primary citation

Structural Insights into Mitochondrial Antiviral Signaling Protein (MAVS)-Tumor Necrosis Factor Receptor-associated Factor 6 (TRAF6) Signaling. Shi, Z., Zhang, Z., Zhang, Z. et al. J Biol Chem (2015) 290:26811-26820. DOI 10.1074/jbc.M115.666578 · PubMed

Other PDB entries of the same protein (UniProt Q9Y4K3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LB6 1.8 Å, TRAF6-CD40 Complex
3HCT 2.1 Å, Crystal structure of TRAF6 in complex with Ubc13 in the P1 space group
6A33 2.1 Å, Binding and Enhanced Binding between Key Immunity Proteins TRAF6 and TIFA
3HCS 2.2 Å, Crystal structure of the N-terminal domain of TRAF6
1LB4 2.4 Å, TRAF6 apo structure
1LB5 2.4 Å, TRAF6-RANK Complex
3HCU 2.6 Å, Crystal structure of TRAF6 in complex with Ubc13 in the C2 space group
5ZUJ 2.6 Å, Binding and Enhanced Binding between Key Immunity Proteins TRAF6 and TIFA
8HZ2 2.6 Å, Tumor Necrosis Factor Receptor Associated Factor 6 (TRAF6) N-terminal Domain
7L3L 2.8 Å, Structure of TRAF5 and TRAF6 RING Hetero dimer
2ECI Solution structure of the RING domain of the human TNF receptor-associated factor 6…
2JMD Solution Structure of the Ring Domain of Human TRAF6

Browse structure collections

About this viewer

MolViewer shows 4Z8M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.