4Z9P: Ebola virus nucleoprotein core domain

Crystal structure of Ebola virus nucleoprotein core domain at 1.8A resolution. Determined by X-ray diffraction at 1.79 Å resolution. Released 20 May 2015.

Method: X-ray diffraction
Resolution: 1.79 Å
Organism: Zaire ebolavirus (strain Mayinga-76)
Chains: 1
Atoms: 2,512
Mol. weight: 35.13 kDa
Released: 20 May 2015

Explore 4Z9P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4Z9P contains 25 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	39-45	7	1
α-helix	49-61	13
α-helix	67-69	3
α-helix	70-82	13
α-helix	87-91	5
α-helix	94-100	7
β-strand	104-110	7	1
α-helix	117-120	4
α-helix	128-135	8
α-helix	147-155	9
α-helix	161-163	3
α-helix	165-181	17
α-helix	189-192	4
α-helix	194-206	13
α-helix	208-219	12
α-helix	221-222	2
α-helix	227-239	13
α-helix	245-249	5
α-helix	250-254	5
β-strand	255	1	2
β-strand	264	1	2
α-helix	266-268	3
α-helix	271-273	3
α-helix	274-288	15
α-helix	291-296	6
α-helix	305-308	4
α-helix	310-312	3
α-helix	314-324	11
α-helix	336-349	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoprotein	A	protein	317	Zaire ebolavirus (strain Mayinga-76)	P18272 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4Z9P_1 Nucleoprotein (chains A)
AVRQRVIPVYQVNNLEEICQLIIQAFEAGVDFQESADSFLLMLCLHHAYQGDYKLFLESG
AVKYLEGHGFRFEVKKRDGVKRLEELLPAVSSGKNIKRTLAAMPEEETTEANAGQFLSFA
SLFLPKLVVGEKACLEKVQRQIQVHAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLIKFLL
IHQGMHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKTERGVRLHPLARTAKVK
NEVNSFKAALSSLAKHGEYAPFARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGV
NVGEQYQQLREAATEAE

Primary citation

Insight into the Ebola virus nucleocapsid assembly mechanism: crystal structure of Ebola virus nucleoprotein core domain at 1.8 A resolution. Dong, S., Yang, P., Li, G. et al. Protein Cell (2015) 6:351-362. DOI 10.1007/s13238-015-0163-3 · PubMed

Other PDB entries of the same protein (UniProt P18272 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4QB0 1.75 Å, The crystal structure of the C-terminal domain of Ebola (Zaire) nucleoprotein
4QAZ 1.98 Å, The crystal structure of the C-terminal domain of Ebola (Zaire) nucleoprotein
5T3T 2.2 Å, Ebola virus VP30 CTD bound to nucleoprotein
4ZTA 2.4 Å, Ebola virus nucleoprotein bound to VP35 chaperoning peptide I212121
4ZTI 2.4 Å, Ebola virus nucleoprotein bound to VP35 chaperoning peptide P212121
4ZTG 2.8 Å, Ebola virus nucleoprotein bound to VP35 chaperoning peptide P22121
6NUT 3.1 Å, Ebola virus nucleoprotein - RNA complex
5Z9W 3.6 Å, Ebola virus nucleoprotein-RNA complex
4YPI 3.71 Å, Structure of Ebola virus nucleoprotein N-terminal fragment bound to a peptide derived…
8Y9J 4.6 Å, Structure of the Ebola virus nucleocapsid subunit
6C54 5.8 Å, Ebola nucleoprotein nucleocapsid-like assembly and the asymmetric unit
6EHL 6.6 Å, Model of the Ebola virus nucleoprotein in recombinant nucleocapsid-like assemblies

Browse structure collections

About this viewer

MolViewer shows 4Z9P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.