4ZTI: Ebola virus nucleoprotein

Ebola virus nucleoprotein bound to VP35 chaperoning peptide P212121. Determined by X-ray diffraction at 2.4 Å resolution. Released 27 May 2015.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Zaire ebolavirus (strain Mayinga-76)
Chains: 2
Atoms: 5,508
Mol. weight: 84.62 kDa
Released: 27 May 2015

Explore 4ZTI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ZTI contains 48 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1-7	7
α-helix	13-15	3
β-strand	39-45	7	1
α-helix	49-62	14
α-helix	67-69	3
α-helix	70-82	13
α-helix	87-92	6
α-helix	94-101	8
β-strand	104-110	7	1
α-helix	117-119	3
α-helix	133-135	3
α-helix	147-155	9
α-helix	165-181	17
α-helix	189-192	4
α-helix	194-206	13
α-helix	208-219	12
α-helix	227-238	12
α-helix	245-254	10
β-strand	255-258	4	2
β-strand	261-264	4	2
α-helix	266-269	4
α-helix	271-273	3
α-helix	274-288	15
α-helix	291-296	6
α-helix	305-307	3
α-helix	310-312	3
α-helix	314-325	12
α-helix	338-340	3
α-helix	341-359	19

Chain B: 23 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1-7	7
α-helix	13-15	3
β-strand	39-45	7	3
α-helix	49-62	14
α-helix	67-69	3
α-helix	70-82	13
α-helix	87-91	5
α-helix	94-100	7
β-strand	104-110	7	3
α-helix	117-119	3
α-helix	147-155	9
α-helix	165-181	17
α-helix	189-192	4
α-helix	194-206	13
α-helix	208-220	13
α-helix	227-238	12
α-helix	245-254	10
β-strand	255-258	4	4
β-strand	261-264	4	4
α-helix	266-269	4
α-helix	271-273	3
α-helix	274-288	15
α-helix	291-296	6
α-helix	305-308	4
α-helix	310-312	3
α-helix	314-326	13
α-helix	341-363	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polymerase cofactor VP35,Nucleoprotein	A, B	protein	381	Zaire ebolavirus (strain Mayinga-76)	P18272 (AlphaFold model), Q05127 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4ZTI_1 Polymerase cofactor VP35,Nucleoprotein (chains A, B)
GTQNDRMPGPELSGWISEQLMTGRIPVSDIFCDIENNPGLCYASQMQGIVRQRVIPVYQV
NNLEEICQLIIQAFEAGVDFQESADSFLLMLCLHHAYQGDYKLFLESGAVKYLEGHGFRF
EVKKRDGVKRLEELLPAVSSGKNIKRTLAAMPEEETTEANAGQFLSFASLFLPKLVVGEK
ACLEKVQRQIQVHAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLIKFLLIHQGMHMVAGHD
ANDAVISNSVAQARFSGLLIVKTVLDHILQKTERGVRLHPLARTAKVKNEVNSFKAALSS
LAKHGEYAPFARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGVNVGEQYQQLREA
ATEAEKQLQQYAESRELDHLG

Primary citation

Ebola virus nucleoprotein bound to VP35 chaperoning peptide P212121. Kirchdoerfer, R.N., Abelson, D.M., Li, S. et al. To be published.

Other PDB entries of the same protein (UniProt P18272 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4QB0 1.75 Å, The crystal structure of the C-terminal domain of Ebola (Zaire) nucleoprotein
4Z9P 1.79 Å, Crystal structure of Ebola virus nucleoprotein core domain at 1.8A resolution
4QAZ 1.98 Å, The crystal structure of the C-terminal domain of Ebola (Zaire) nucleoprotein
5T3T 2.2 Å, Ebola virus VP30 CTD bound to nucleoprotein
4ZTA 2.4 Å, Ebola virus nucleoprotein bound to VP35 chaperoning peptide I212121
4ZTG 2.8 Å, Ebola virus nucleoprotein bound to VP35 chaperoning peptide P22121
6NUT 3.1 Å, Ebola virus nucleoprotein - RNA complex
5Z9W 3.6 Å, Ebola virus nucleoprotein-RNA complex
4YPI 3.71 Å, Structure of Ebola virus nucleoprotein N-terminal fragment bound to a peptide derived…
8Y9J 4.6 Å, Structure of the Ebola virus nucleocapsid subunit
6C54 5.8 Å, Ebola nucleoprotein nucleocapsid-like assembly and the asymmetric unit
6EHL 6.6 Å, Model of the Ebola virus nucleoprotein in recombinant nucleocapsid-like assemblies

Browse structure collections

About this viewer

MolViewer shows 4ZTI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.