6C54: Nucleoprotein

Ebola nucleoprotein nucleocapsid-like assembly and the asymmetric unit. Determined by electron microscopy at 5.8 Å resolution. Released 7 Mar 2018.

Method: Electron microscopy
Resolution: 5.8 Å
Organism: Zaire ebolavirus
Chains: 2
Atoms: 5,664
Mol. weight: 96.29 kDa
Released: 7 Mar 2018

Explore 6C54 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6C54 contains 44 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	40-45	6	1
α-helix	49-62	14
α-helix	69-73	5
α-helix	75-80	6
α-helix	87-91	5
α-helix	94-100	7
β-strand	105-110	6	1
α-helix	128-136	9
α-helix	147-155	9
α-helix	158-160	3
α-helix	165-181	17
α-helix	194-206	13
α-helix	209-215	7
α-helix	216-220	5
α-helix	227-238	12
α-helix	245-253	9
β-strand	256	1	2
β-strand	263	1	2
α-helix	271-273	3
α-helix	274-287	14
α-helix	294-296	3
α-helix	297-300	4
α-helix	303-306	4
α-helix	316-326	11
α-helix	341-362	22
α-helix	370-382	13

Chain B: 22 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	42	1
β-strand	43-45	3	3
α-helix	49-62	14
α-helix	69-77	9
α-helix	78-82	5
α-helix	87-91	5
α-helix	94-100	7
β-strand	108-110	3	3
β-strand	114	1	4
β-strand	116	1	4
α-helix	117-119	3
α-helix	127-136	10
α-helix	147-155	9
α-helix	158-160	3
α-helix	165-182	18
α-helix	194-206	13
α-helix	208-219	12
α-helix	227-238	12
α-helix	245-253	9
β-strand	255-258	4	5
β-strand	261-264	4	5
α-helix	274-287	14
α-helix	288-293	6
α-helix	304-307	4
α-helix	316-326	11
α-helix	341-365	25
α-helix	370-383	14
α-helix	393-410	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoprotein	A, B	protein	433	Zaire ebolavirus	P18272 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6C54_1 Nucleoprotein (chains A, B)
LTAGLSVQQGIVRQRVIPVYQVNNLEEICQLIIQAFEAGVDFQESADSFLLMLCLHHAYQ
GDYKLFLESGAVKYLEGHGFRFEVKKRDGVKRLEELLPAVSSGKNIKRTLAAMPEEETTE
ANAGQFLSFASLFLPKLVVGEKACLEKVQRQIQVHAEQGLIQYPTAWQSVGHMMVIFRLM
RTNFLIKFLLIHQGMHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKTERGVRL
HPLARTAKVKNEVNSFKAALSSLAKHGEYAPFARLLNLSGVNNLEHGLFPQLSAIALGVA
TAHGSTLAGVNVGEQYQQLREAATEAEKQLQQYAESRELDHLGLDDQEKKILMNFHQKKN
EISFQQTNAMVTLRKERLAKLTEAITAASLPKTSGHYDDDDDIPFPGPINDDDNPGHQDD
DPTDSQDTTIPDV

Primary citation

Electron Cryo-microscopy Structure of Ebola Virus Nucleoprotein Reveals a Mechanism for Nucleocapsid-like Assembly. Su, Z., Wu, C., Shi, L. et al. Cell (2018) 172:966-978.e12. DOI 10.1016/j.cell.2018.02.009 · PubMed

Other PDB entries of the same protein (UniProt P18272 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4QB0 1.75 Å, The crystal structure of the C-terminal domain of Ebola (Zaire) nucleoprotein
4Z9P 1.79 Å, Crystal structure of Ebola virus nucleoprotein core domain at 1.8A resolution
4QAZ 1.98 Å, The crystal structure of the C-terminal domain of Ebola (Zaire) nucleoprotein
5T3T 2.2 Å, Ebola virus VP30 CTD bound to nucleoprotein
4ZTA 2.4 Å, Ebola virus nucleoprotein bound to VP35 chaperoning peptide I212121
4ZTI 2.4 Å, Ebola virus nucleoprotein bound to VP35 chaperoning peptide P212121
4ZTG 2.8 Å, Ebola virus nucleoprotein bound to VP35 chaperoning peptide P22121
6NUT 3.1 Å, Ebola virus nucleoprotein - RNA complex
5Z9W 3.6 Å, Ebola virus nucleoprotein-RNA complex
4YPI 3.71 Å, Structure of Ebola virus nucleoprotein N-terminal fragment bound to a peptide derived…
8Y9J 4.6 Å, Structure of the Ebola virus nucleocapsid subunit
6EHL 6.6 Å, Model of the Ebola virus nucleoprotein in recombinant nucleocapsid-like assemblies

Browse structure collections

About this viewer

MolViewer shows 6C54 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.