4ZAU: AZD9291 complex with wild type EGFR

AZD9291 complex with wild type EGFR. Determined by X-ray diffraction at 2.8 Å resolution. Released 11 Nov 2015.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,218
Mol. weight: 38.06 kDa
Ligands: YY3
Released: 11 Nov 2015

Explore 4ZAU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ZAU contains 18 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	706	1	1
α-helix	709-711	3
β-strand	712-721	10	1
β-strand	724-731	8	1
β-strand	739	1	2
β-strand	740-745	6	1
α-helix	757-767	11
β-strand	774	1	3
β-strand	777-782	6	1
β-strand	786-791	6	1
β-strand	796-797	2	3
α-helix	798-805	8
α-helix	806-808	3
α-helix	811-830	20
β-strand	833-834	2	4
α-helix	840-842	3
β-strand	843-847	5	3
β-strand	850-853	4	3
β-strand	860-861	2	4
β-strand	869-870	2	5
α-helix	878-880	3
α-helix	883-888	6
β-strand	890-891	2	5
α-helix	893-908	16
α-helix	912-913	2
α-helix	920-929	10
α-helix	933-936	4
β-strand	939	1	6
α-helix	941-949	9
α-helix	955-957	3
α-helix	959-960	2
α-helix	961-971	11
α-helix	975-978	4
β-strand	979	1	6
β-strand	1010	1	2
α-helix	1013-1015	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Epidermal growth factor receptor	A	protein	330	Homo sapiens	P00533 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4ZAU_1 Epidermal growth factor receptor (chains A)
GAMGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATS
PKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQ
YLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAE
GGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGER
LPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSP
TDSNFYRALMDEEDMDDVVDADEYLIPQQG

Ligands and cofactors

ID	Name	Formula	Copies
YY3	N-(2-{[2-(dimethylamino)ethyl](methyl)amino}-4-methoxy-5-{[4-(1-methyl-1H-indol…	C28 H33 N7 O2	1

Primary citation

Binding mode of the breakthrough inhibitor AZD9291 to epidermal growth factor receptor revealed. Yosaatmadja, Y., Silva, S., Dickson, J.M. et al. J Struct Biol (2015) 192:539-544. DOI 10.1016/j.jsb.2015.10.018 · PubMed

Other PDB entries of the same protein (UniProt P00533 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8A27 1.07 Å, EGFR kinase domain in complex with 2-(6,7-dihydro-5H-pyrrolo[1,2-c]imidazol-1-yl)-2-[6-[2…
8A2D 1.11 Å, EGFR kinase domain (L858R/V948R) in complex with 2-[4-(difluoromethyl)-6-[2-[4-[[4-(hydro…
5UG9 1.33 Å, Crystal structure of the EGFR kinase domain (L858R, T790M, V948R) in complex with a…
5HG8 1.42 Å, EGFR (L858R, T790M, V948R) in complex with N-[3-({2-[(1-methyl-1H-pyrazol-4-yl)amino]-7H-…
8A2A 1.43 Å, EGFR kinase domain in complex with 2-(6,7-dihydro-5H-pyrrolo[1,2-c]imidazol-1-yl)-2-[6-[2…
5UG8 1.46 Å, Crystal structure of the EGFR kinase domain (L858R, T790M, V948R) in complex with a…
3POZ 1.5 Å, EGFR Kinase domain complexed with tak-285
6TFV 1.5 Å, Crystal Structure of EGFR T790M/V948R in Complex with Covalent Pyrrolopyrimidine 18b
6TG0 1.5 Å, Crystal Structure of EGFR T790M/V948R in Complex with Covalent Pyrrolopyrimidine 21a
3VRP 1.52 Å, Crystal structure of the tyrosine kinase binding domain of Cbl-c in complex with…
5HG5 1.52 Å, EGFR (L858R, T790M, V948R) in complex with N-{3-[(2-{[4-(4-methylpiperazin-1-yl)phenyl]am…
5CNO 1.55 Å, Crystal structure of the EGFR kinase domain mutant V924R

Browse more

4ZAU is part of these collections:

Kinases and cancer drug targets

About this viewer

MolViewer shows 4ZAU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.