Mitogen activated protein kinase 7 in complex with inhibitor. Determined by X-ray diffraction at 2.48 Å resolution. Released 4 May 2016.
Explore 4ZSJ in 3D Show helices and sheets RCSB PDB PDBe
4ZSJ contains 26 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 55-63 | 9 | 1 |
| β-strand | 67-74 | 8 | 1 |
| β-strand | 80-86 | 7 | 1 |
| α-helix | 93-108 | 16 | |
| β-strand | 114 | 1 | 2 |
| β-strand | 117-120 | 4 | 1 |
| α-helix | 121-123 | 3 | |
| α-helix | 127-129 | 3 | |
| β-strand | 133-138 | 6 | 1 |
| β-strand | 142-143 | 2 | 2 |
| α-helix | 144-148 | 5 | |
| α-helix | 156-175 | 20 | |
| β-strand | 179 | 1 | 3 |
| α-helix | 185-187 | 3 | |
| β-strand | 188-190 | 3 | 2 |
| β-strand | 196-198 | 3 | 2 |
| β-strand | 205 | 1 | 3 |
| α-helix | 214-216 | 3 | |
| α-helix | 219-221 | 3 | |
| α-helix | 225-227 | 3 | |
| α-helix | 230-234 | 5 | |
| α-helix | 242-257 | 16 | |
| α-helix | 267-278 | 12 | |
| α-helix | 281-282 | 2 | |
| α-helix | 283-287 | 5 | |
| α-helix | 292-299 | 8 | |
| α-helix | 302-303 | 2 | |
| α-helix | 305-308 | 4 | |
| α-helix | 309-312 | 4 | |
| α-helix | 318-327 | 10 | |
| α-helix | 332-334 | 3 | |
| α-helix | 336-337 | 2 | |
| α-helix | 338-342 | 5 | |
| α-helix | 345-347 | 3 | |
| α-helix | 353-355 | 3 | |
| α-helix | 366-369 | 4 | |
| α-helix | 374-392 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mitogen-activated protein kinase 7 | A | protein | 344 | Homo sapiens | Q13164 (AlphaFold model) |
>4ZSJ_1 Mitogen-activated protein kinase 7 (chains A) DVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHF KHDNIIAIKDILRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRG LKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRA PELMLSLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAV GAERVRAYIQSLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAK YHDPDDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARRE
| ID | Name | Formula | Copies |
|---|---|---|---|
| 4R0 | 3-amino-5-[(4-chloro-3-methylphenyl)amino]-N-(propan-2-yl)-1H-1,2,4-triazole-1-… | C13 H17 Cl N6 O | 1 |
Water and common crystallization additives (GOL) are not listed.
Discovery of a novel allosteric inhibitor-binding site in ERK5: comparison with the canonical kinase hinge ATP-binding site. Chen, H., Tucker, J., Wang, X. et al. Acta Crystallogr D Struct Biol (2016) 72:682-693. DOI 10.1107/S2059798316004502 · PubMed
Other PDB entries of the same protein (UniProt Q13164 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4ZSJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.