Caspase-7 Variant 2 (V2) with reprogrammed substrate specificity due to Y230V/W232M/Q276C substitutions bound to VEID inhibitor. Determined by X-ray diffraction at 2.5 Å resolution. Released 20 Apr 2016.
Explore 4ZVQ in 3D Show helices and sheets RCSB PDB PDBe
4ZVQ contains 20 α-helices and 40 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 59 | 1 | 1 |
| β-strand | 66-74 | 9 | 2 |
| α-helix | 80-82 | 3 | |
| α-helix | 84-86 | 3 | |
| α-helix | 90-104 | 15 | |
| β-strand | 106-112 | 7 | 2 |
| α-helix | 116-128 | 13 | |
| β-strand | 134-142 | 9 | 2 |
| β-strand | 145-146 | 2 | 3 |
| β-strand | 149-152 | 4 | 3 |
| β-strand | 155-158 | 4 | 3 |
| α-helix | 159-163 | 5 | |
| α-helix | 164-166 | 3 | |
| α-helix | 172-174 | 3 | |
| β-strand | 179-184 | 6 | 2 |
| β-strand | 188-190 | 3 | 4 |
| β-strand | 192 | 1 | 5 |
| β-strand | 195 | 1 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 213 | 1 | 7 |
| β-strand | 219-223 | 5 | 2 |
| β-strand | 228-229 | 2 | 4 |
| β-strand | 232-234 | 3 | 8 |
| β-strand | 238-239 | 2 | 8 |
| α-helix | 240-252 | 13 | |
| α-helix | 258-272 | 15 | |
| α-helix | 280-282 | 3 | |
| β-strand | 286 | 1 | 5 |
| β-strand | 290-293 | 4 | 2 |
| β-strand | 298 | 1 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 359 | 1 | 9 |
| β-strand | 366-374 | 9 | 2 |
| α-helix | 380-382 | 3 | |
| α-helix | 384-386 | 3 | |
| α-helix | 390-404 | 15 | |
| β-strand | 406-412 | 7 | 2 |
| α-helix | 416-428 | 13 | |
| β-strand | 434-442 | 9 | 2 |
| β-strand | 445-446 | 2 | 10 |
| β-strand | 449-452 | 4 | 10 |
| β-strand | 455-458 | 4 | 10 |
| α-helix | 459-463 | 5 | |
| α-helix | 464-466 | 3 | |
| α-helix | 472-474 | 3 | |
| β-strand | 479-484 | 6 | 2 |
| β-strand | 488-490 | 3 | 11 |
| β-strand | 492 | 1 | 12 |
| β-strand | 495 | 1 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 513 | 1 | 6 |
| β-strand | 519-523 | 5 | 2 |
| β-strand | 528-529 | 2 | 11 |
| β-strand | 532-534 | 3 | 13 |
| β-strand | 538-539 | 2 | 13 |
| α-helix | 540-552 | 13 | |
| α-helix | 558-572 | 15 | |
| α-helix | 580-582 | 3 | |
| β-strand | 586 | 1 | 12 |
| β-strand | 590-593 | 4 | 2 |
| β-strand | 598 | 1 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Caspase-7 | A, C | protein | 198 | Homo sapiens | P55210 (AlphaFold model) |
| Caspase-7 | B, D | protein | 113 | Homo sapiens | P55210 (AlphaFold model) |
| Peptide ACE-VAL-GLU-ILE-ASA | E, F | protein | 5 | synthetic construct |
>4ZVQ_1 Caspase-7 (chains A, C) MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL FFIQACRGTELDDGIQAD
>4ZVQ_2 Caspase-7 (chains B, D) SGPINDTDANPRYKIPVEADFLFAYSTVPGYVSMRSPGRGSWFVQALCSILEEHGKDLEI MQILTRVNDRVARHFESCSDDPHFHEKKQIPCVVSMLTKELYFSQLEHHHHHH
>4ZVQ_3 Peptide ACE-VAL-GLU-ILE-ASA (chains E, F) XVEID
Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition. Hill, M.E., MacPherson, D.J., Wu, P. et al. ACS Chem Biol (2016) 11:1603-1612. DOI 10.1021/acschembio.5b00971 · PubMed
Other PDB entries of the same protein (UniProt P55210 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4ZVQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.