5A15: BTB domain of human KCTD16

Crystal structure of the BTB domain of human KCTD16. Determined by X-ray diffraction at 2.76 Å resolution. Released 4 Nov 2015.

Method: X-ray diffraction
Resolution: 2.76 Å
Organism: HOMO SAPIENS
Chains: 15
Atoms: 11,810
Mol. weight: 209.44 kDa
Released: 4 Nov 2015

Explore 5A15 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5A15 contains 90 α-helices and 60 β-strands across 15 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	1
β-strand	34-39	6	1
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	1
β-strand	73-75	3	1
α-helix	82-91	10
α-helix	96-97	2
α-helix	103-112	10
α-helix	116-121	6

Chains B, E, F and K: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	2
β-strand	34-39	6	2
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	2
β-strand	73-75	3	2
α-helix	82-91	10
α-helix	96-97	2
α-helix	103-112	10
α-helix	116-122	7

Chains C, D, H, L, M and N: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	3
β-strand	34-39	6	3
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	3
β-strand	73-75	3	3
α-helix	82-91	10
α-helix	95-97	3
α-helix	103-112	10
α-helix	116-122	7

Chain G: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	7
β-strand	34-39	6	7
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	7
β-strand	73-75	3	7
α-helix	82-91	10
α-helix	95-97	3
α-helix	103-113	11
α-helix	116-122	7

Chains I and J: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	9
β-strand	34-39	6	9
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	9
β-strand	73-75	3	9
α-helix	79-91	13
α-helix	96-97	2
α-helix	103-112	10
α-helix	116-122	7

Chain O: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	15
β-strand	34-39	6	15
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	15
β-strand	73-75	3	15
α-helix	79-91	13
α-helix	95-97	3
α-helix	103-112	10
α-helix	116-122	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Btb/poz domain-containing protein KCTD16	A, B, C, D, E, F, G, H, I, J, K, L, M, N, O	protein	120	HOMO SAPIENS	Q68DU8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O), FASTA

>5A15_1 BTB/POZ DOMAIN-CONTAINING PROTEIN KCTD16 (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O)
SMGSAVPNSFPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSPKRDTANDLAKDSKGRF
FIDRDGFLFRYILDYLRDRQVVLPDHFPEKGRLKREAEYFQLPDLVKLLTPDEIKQSPDE

Primary citation

Structural complexity in the KCTD family of Cullin3-dependent E3 ubiquitin ligases. Pinkas, D.M., Sanvitale, C.E., Bufton, J.C. et al. Biochem J (2017) 474:3747-3761. DOI 10.1042/BCJ20170527 · PubMed

Other PDB entries of the same protein (UniProt Q68DU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QB7 2.23 Å, Structure of the H1 domain of human KCTD16
6OCR 2.28 Å, Crystal structure of human KCTD16 T1 domain
6I0Q 2.3 Å, Crystal structure of BTB domain of KCTD16 hexamer
6OCP 2.35 Å, Crystal structure of a human GABAB receptor peptide bound to KCTD16 T1
6OCT 2.8 Å, Crystal structure of human KCTD16 T1 domain
6M8R 3.2 Å, Crystal structure of the KCTD16 BTB domain in complex with GABAB2 peptide

Browse structure collections

About this viewer

MolViewer shows 5A15 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.