5A48: Maternal effect protein oskar

Crystal structure of the LOTUS domain (aa 139-240) of Drosophila Oskar in P65. Determined by X-ray diffraction at 2.35 Å resolution. Released 22 Jul 2015.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: DROSOPHILA MELANOGASTER
Chains: 2
Atoms: 1,469
Mol. weight: 23.4 kDa
Released: 22 Jul 2015

Explore 5A48 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5A48 contains 12 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	142-145	4
α-helix	146-152	7
α-helix	156-165	10
β-strand	172	1	1
α-helix	174-185	12
α-helix	195-199	5
β-strand	205-209	5	1
β-strand	215-219	5	1

Chain B: 7 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	142-145	4
α-helix	146-152	7
α-helix	156-166	11
β-strand	172	1	1
α-helix	174-185	12
α-helix	195-199	5
β-strand	205-209	5	1
β-strand	215-219	5	1
α-helix	220-222	3
α-helix	226-228	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maternal effect protein oskar	A, B	protein	104	DROSOPHILA MELANOGASTER	P25158 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5A48_1 MATERNAL EFFECT PROTEIN OSKAR (chains A, B)
GHMTIIESNYISVREEYPDIDSEVRAILLSHAQNGITISSIKSEYRKLTGNPFPLHDNVT
DFLLTIPNVTAECSESGKRIFNLKASLKNGHLLDMVLNQKERTS

Primary citation

The Crystal Structure of the Drosophila Germline Inducer Oskar Identifies Two Domains with Distinct Vasa Helicase-and RNA-Binding Activities. Jeske, M., Bordi, M., Glatt, S. et al. Cell Rep (2015) 12:587. DOI 10.1016/J.CELREP.2015.06.055 · PubMed

Other PDB entries of the same protein (UniProt P25158 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NT7 1.4 Å, Structure of the LOTUS domain of Oskar in complex with the C-terminal RecA-like domain…
5A4A 1.7 Å, Crystal structure of the OSK domain of Drosophila Oskar
5A49 2.1 Å, Crystal structure of the LOTUS domain (aa 139-222) of Drosophila Oskar in C222
5CD9 2.1 Å, Crystal structure of the CTD of Drosophila Oskar protein
5CD7 2.5 Å, Crystal structure of the NTD L199M of Drosophila Oskar protein
5CD8 3.0 Å, Crystal structure of the NTD of Drosophila Oskar protein

Browse structure collections

About this viewer

MolViewer shows 5A48 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.