5A49: Maternal effect protein oskar

Crystal structure of the LOTUS domain (aa 139-222) of Drosophila Oskar in C222. Determined by X-ray diffraction at 2.1 Å resolution. Released 22 Jul 2015.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: DROSOPHILA MELANOGASTER
Chains: 10
Atoms: 5,973
Mol. weight: 98.35 kDa
Released: 22 Jul 2015

Explore 5A49 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5A49 contains 42 α-helices and 32 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	149-152	4
α-helix	156-167	12
β-strand	169	1	1
β-strand	171	1	1
β-strand	172	1	2
α-helix	174-185	12
α-helix	195-199	5
β-strand	205-209	5	2
β-strand	215-219	5	2
α-helix	220-221	2

Chains B and F: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	149-152	4
α-helix	156-166	11
β-strand	172	1	3
α-helix	174-185	12
α-helix	195-199	5
β-strand	205-209	5	3
β-strand	215-219	5	3

Chains C and J: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	147-152	6
α-helix	156-166	11
β-strand	172	1	3
α-helix	174-185	12
α-helix	195-199	5
β-strand	205-209	5	3
β-strand	215-219	5	3

Chain D: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	161-166	6
β-strand	172-173	2	4
α-helix	174-180	7
α-helix	195-199	5
β-strand	206-209	4	4
β-strand	215-218	4	4

Chain E: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	156-167	12
β-strand	172	1	4
α-helix	174-185	12
α-helix	195-199	5
β-strand	205-209	5	4
β-strand	215-219	5	4
α-helix	220-221	2

Chain G: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	149-152	4
α-helix	156-165	10
β-strand	172	1	5
α-helix	174-185	12
α-helix	195-199	5
β-strand	206-209	4	5
β-strand	215-218	4	5

Chains H and I: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	149-152	4
α-helix	156-166	11
β-strand	172	1	6
α-helix	174-185	12
α-helix	195-199	5
β-strand	205-209	5	6
β-strand	215-219	5	6
α-helix	220-221	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maternal effect protein oskar	A, B, C, D, E, F, G, H, I, J	protein	89	DROSOPHILA MELANOGASTER	P25158 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA

>5A49_1 MATERNAL EFFECT PROTEIN OSKAR (chains A, B, C, D, E, F, G, H, I, J)
GPLGSMTIIESNYISVREEYPDIDSEVRAILLSHAQNGITISSIKSEYRKLTGNPFPLHD
NVTDFLLTIPNVTAECSESGKRIFNLKAS

Primary citation

The Crystal Structure of the Drosophila Germline Inducer Oskar Identifies Two Domains with Distinct Vasa Helicase-and RNA-Binding Activities. Jeske, M., Bordi, M., Glatt, S. et al. Cell Rep (2015) 12:587. DOI 10.1016/J.CELREP.2015.06.055 · PubMed

Other PDB entries of the same protein (UniProt P25158 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NT7 1.4 Å, Structure of the LOTUS domain of Oskar in complex with the C-terminal RecA-like domain…
5A4A 1.7 Å, Crystal structure of the OSK domain of Drosophila Oskar
5CD9 2.1 Å, Crystal structure of the CTD of Drosophila Oskar protein
5A48 2.35 Å, Crystal structure of the LOTUS domain (aa 139-240) of Drosophila Oskar in P65
5CD7 2.5 Å, Crystal structure of the NTD L199M of Drosophila Oskar protein
5CD8 3.0 Å, Crystal structure of the NTD of Drosophila Oskar protein

Browse structure collections

About this viewer

MolViewer shows 5A49 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.