5NT7: LOTUS domain of Oskar

Structure of the LOTUS domain of Oskar in complex with the C-terminal RecA-like domain of Vasa. Determined by X-ray diffraction at 1.4 Å resolution. Released 17 May 2017.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Drosophila melanogaster
Chains: 4
Atoms: 4,466
Mol. weight: 60.33 kDa
Released: 17 May 2017

Explore 5NT7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5NT7 contains 28 α-helices and 18 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	147-152	6
α-helix	156-166	11
β-strand	172	1	2
α-helix	174-185	12
α-helix	195-199	5
β-strand	205-209	5	2
β-strand	215-219	5	2
α-helix	226-233	8

Chain B: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	466-471	6	1
α-helix	474-476	3
α-helix	477-487	11
β-strand	492-496	5	1
α-helix	499-511	13
β-strand	516-519	4	1
α-helix	525-537	13
β-strand	542-546	5	1
α-helix	547-550	4
β-strand	560-563	4	1
α-helix	570-577	8
β-strand	588-593	6	1
α-helix	599-601	3
α-helix	602-611	10
α-helix	614-617	4
α-helix	618-620	3

Chain D: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	466-471	6	3
α-helix	474-476	3
α-helix	477-487	11
β-strand	492-496	5	3
α-helix	499-511	13
β-strand	516-519	4	3
α-helix	525-537	13
β-strand	542-546	5	3
β-strand	560-563	4	3
α-helix	570-577	8
β-strand	588-593	6	3
α-helix	599-601	3
α-helix	602-611	10
α-helix	618-621	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ATP-dependent RNA helicase vasa, isoform A	B, D	protein	163	Drosophila melanogaster	P09052 (AlphaFold model)
Maternal effect protein oskar	A, C	protein	107	Drosophila melanogaster	P25158 (AlphaFold model)

Sequence of entity 1 (B, D), FASTA

>5NT7_1 ATP-dependent RNA helicase vasa, isoform A (chains B, D)
GHSDVKQTIYEVNKYAKRSKLIEILSEQADGTIVFVETKRGADFLASFLSEKEFPTTSIH
GDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRT
GRVGNNGRATSFFDPEKDRAIAADLVKILEGSGQTVPDFLRTC

Sequence of entity 2 (A, C), FASTA

>5NT7_2 Maternal effect protein oskar (chains A, C)
GPLGSMTIIESNYISVREEYPDIDSEVRAILLSHAQNGITISSIKSEYRKLTGNPFPLHD
NVTDFLLTIPNVTAECSESGKRIFNLKASLKNGHLLDMVLNQKERTS

Primary citation

The LOTUS domain is a conserved DEAD-box RNA helicase regulator essential for the recruitment of Vasa to the germ plasm and nuage. Jeske, M., Muller, C.W., Ephrussi, A. Genes Dev (2017) 31:939-952. DOI 10.1101/gad.297051.117 · PubMed

Other PDB entries of the same protein (UniProt P09052 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EMW 1.8 Å, Crystal Structure of human splA/ryanodine receptor domain and SOCS box containing 2…
3F2O 2.05 Å, Crystal Structure of human splA/ryanodine receptor domain and SOCS box containing 1…
2DB3 2.2 Å, Structural basis for RNA unwinding by the DEAD-box protein Drosophila Vasa
2IHS 2.2 Å, Crystal structure of the B30.2/SPRY domain of GUSTAVUS in complex with a 20-residue VASA…

Browse structure collections

About this viewer

MolViewer shows 5NT7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.