5A6U: SEC61A

Native mammalian ribosome-bound Sec61 protein-conducting channel in the 'non-inserting' state. Determined by electron microscopy at 9.0 Å resolution. Released 7 Oct 2015.

Method: Electron microscopy
Resolution: 9.0 Å
Organism: CANIS LUPUS FAMILIARIS
Chains: 3
Atoms: 3,778
Mol. weight: 60.33 kDa
Released: 7 Oct 2015

Explore 5A6U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5A6U contains 22 α-helices and 4 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	28-45	18
α-helix	64-68	5
α-helix	82-96	15
α-helix	106-132	27
α-helix	150-165	16
α-helix	178-192	15
α-helix	216-222	7
α-helix	223-225	3
α-helix	241-259	19
β-strand	263-268	6	1
β-strand	269	1	2
β-strand	276-281	6	1
α-helix	286-288	3
α-helix	289-303	15
α-helix	305-311	7
α-helix	338-343	6
α-helix	360-382	23
α-helix	387-396	10
β-strand	399	1	2
α-helix	407-432	26
α-helix	445-465	21

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	70-85	16

Chain G: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	10-19	10
α-helix	30-46	17
α-helix	50-53	4
α-helix	55-62	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SEC61A	A	protein	451	CANIS LUPUS FAMILIARIS	P38377 (AlphaFold model)
SEC61B	B	protein	36	CANIS LUPUS FAMILIARIS	P60467 (AlphaFold model)
SEC61G	G	protein	62	CANIS LUPUS FAMILIARIS	P60058 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5A6U_1 SEC61A (chains A)
IQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTLMELGISPIV
TSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQSIVYVMTGMYGDPSEMGA
GICLLITIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTVNTGR
GMEFEGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATIFVFAVVIYFQGFRVDL
PIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLSARFSGNLLVSLLGTWS
DTSSGGPARAYPVGGLCHYLSPPESFGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEVSGS
SAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGT
GILLAVTIIYQYFEIFVKEQSEVGSMGALLF

Sequence of entity 2 (B), FASTA

>5A6U_2 SEC61B (chains B)
EDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS

Sequence of entity 3 (G), FASTA

>5A6U_3 SEC61G (chains G)
FVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIV
GG

Primary citation

Structure of the Native Sec61 Protein-Conducting Channel. Pfeffer, S., Burbaum, L., Unverdorben, P. et al. Nat Commun (2015) 6:8403. DOI 10.1038/NCOMMS9403 · PubMed

Other PDB entries of the same protein (UniProt P38377 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Z3T 2.69 Å, Structure of canine Sec61 inhibited by mycolactone
8RJB 2.69 Å, Structure of the rabbit 80S ribosome stalled on a 2-TMD rhodopsin intermediate in…
8RJD 2.79 Å, Structure of the rabbit 80S ribosome stalled on a 2-TMD rhodopsin intermediate in…
8RJC 2.9 Å, Structure of the rabbit 80S ribosome stalled on a 2-TMD rhodopsin intermediate in…
7TM3 3.25 Å, Structure of the rabbit 80S ribosome stalled on a 2-TMD Rhodopsin intermediate in…
8OJ8 3.3 Å, 60S ribosomal subunit bound to the E3-UFM1 complex - state 1 (native)
8BTK 3.5 Å, Structure of the TRAP complex with the Sec translocon and a translating ribosome
3JC2 3.6 Å, The structure of the mammalian Sec61 channel opened by a signal sequence
7TUT 3.88 Å, Structure of the rabbit 80S ribosome stalled on a 4-TMD Rhodopsin intermediate in…
6R7Q 3.9 Å, Structure of XBP1u-paused ribosome nascent chain complex with Sec61.
6FTI 4.2 Å, Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the…
6FTJ 4.7 Å, Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the…

Browse structure collections

About this viewer

MolViewer shows 5A6U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.