5AIR: PDB entry 5AIR

Structural analysis of mouse GSK3beta fused with LRP6 peptide. Determined by X-ray diffraction at 2.53 Å resolution. Released 1 Apr 2015.

Method: X-ray diffraction
Resolution: 2.53 Å
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 5,724
Mol. weight: 95.85 kDa
Ligands: MLI
Released: 1 Apr 2015

Explore 5AIR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5AIR contains 47 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	27-29	3	1
β-strand	37-44	8	1
β-strand	52-64	13	1
β-strand	69-75	7	1
β-strand	81-89	9	1
α-helix	96-103	8
β-strand	109	1	2
β-strand	112-118	7	1
β-strand	126-133	8	1
β-strand	137-138	2	2
α-helix	139-148	10
α-helix	155-174	20
β-strand	177-178	2	3
α-helix	184-186	3
β-strand	187-189	3	2
β-strand	196-198	3	2
α-helix	201-203	3
β-strand	205-206	2	3
α-helix	220-222	3
α-helix	225-228	4
α-helix	237-252	16
β-strand	261	1	4
α-helix	262-273	12
α-helix	275-277	3
α-helix	278-284	7
α-helix	296-299	4
α-helix	301-304	4
α-helix	311-320	10
α-helix	325-327	3
α-helix	329-330	2
α-helix	331-335	5
α-helix	338-340	3
α-helix	341-344	4
α-helix	354-356	3
α-helix	364-367	4
α-helix	371-373	3
α-helix	374-377	4

Chain B: 24 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	26-30	5	5
β-strand	36-44	9	5
β-strand	52-63	12	5
β-strand	68-75	8	5
β-strand	81-88	8	5
α-helix	96-101	6
β-strand	109	1	6
β-strand	112-118	7	5
β-strand	127-133	7	5
β-strand	137-138	2	6
α-helix	139-148	10
α-helix	155-174	20
β-strand	177-178	2	7
α-helix	184-186	3
β-strand	187-189	3	6
β-strand	196-198	3	6
α-helix	201-203	3
β-strand	205-206	2	7
α-helix	207-208	2
β-strand	219	1	4
α-helix	220-222	3
α-helix	225-228	4
α-helix	237-252	16
α-helix	262-273	12
α-helix	275-277	3
α-helix	278-284	7
α-helix	301-303	3
α-helix	311-320	10
α-helix	325-327	3
α-helix	329-330	2
α-helix	331-335	5
α-helix	338-340	3
α-helix	341-344	4
α-helix	355-356	2
α-helix	364-367	4
α-helix	371-373	3
α-helix	374-377	4
α-helix	380-383	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Low-density lipoprotein receptor-related protein 6,Glycogen synthase kinase-3 beta	A, B	protein	430	Homo sapiens, Mus musculus	O75581 (AlphaFold model), Q9WV60 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5AIR_1 Low-density lipoprotein receptor-related protein 6,Glycogen synthase kinase-3 beta (chains A, B)
MEPVPPPPTPRSSRPRTTSFAESCKPVQQPSAFGSMKVSIDKDGSKVTTVVATPGQGPDR
PQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIV
RLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLA
YIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFG
ATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTE
FKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKL
PNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNN
AASASASNST

Ligands and cofactors

ID	Name	Formula	Copies
MLI	Malonate ion	C3 H2 O4	2

Primary citation

Structural Analysis of Mouse Gsk3 Beta Fused with Lrp6 Peptide. Kim, K.L., Kim, J.S., Cha, J.S. et al. Korean Soc Struct Biology (2015) 3:55.

Other PDB entries of the same protein (UniProt O75581 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SOV 1.27 Å, The structure of a beta propeller domain in complex with peptide S
7NAM 1.6 Å, LRP6_E1 in complex with Lr-EET-3.5
8FFE 1.72 Å, Crystal structure of LRP6 E1E2 domains bound to YW210.09 Fab and engineered XWnt8 peptide
3SOB 1.9 Å, The structure of the first YWTD beta propeller domain of LRP6 in complex with a FAB
3SOQ 1.9 Å, The structure of the first YWTD beta propeller domain of LRP6 in complex with a DKK1…
4A0P 1.9 Å, Crystal structure of LRP6P3E3P4E4
8DVM 2.0 Å, Crystal structure of LRP6 E3E4 in complex with disulfide constrained peptide E3.6
4NM5 2.3 Å, Crystal structure of GSK-3/Axin complex bound to phosphorylated Wnt receptor LRP6 c-motif
4NM7 2.3 Å, Crystal structure of GSK-3/Axin complex bound to phosphorylated Wnt receptor LRP6 e-motif
8DVL 2.5 Å, Crystal structure of LRP6 E3E4 in complex with disulfide constrained peptide E3.18
8DVN 2.53 Å, Crystal structure of LRP6 E3E4 in complex with disulfide constrained peptide E3.10
6H15 2.6 Å, Structure of LRP6 P3E3P4E4 in complex with VHH L-P2-B10

Browse structure collections

About this viewer

MolViewer shows 5AIR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.