5APS: General control protein GCN4

Sequence IENKKAD inserted between GCN4 adaptors - Structure A7. Determined by X-ray diffraction at 1.37 Å resolution. Released 27 Jan 2016.

Method: X-ray diffraction
Resolution: 1.37 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 1
Atoms: 626
Mol. weight: 11.21 kDa
Released: 27 Jan 2016

Explore 5APS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5APS contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	7-64	58

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
General control protein GCN4	A	protein	93	SACCHAROMYCES CEREVISIAE	P03069 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5APS_1 GENERAL CONTROL PROTEIN GCN4 (chains A)
MKHHHHHHPMSDYDIPTTENLYFQGHMKQLEDKVEELLSKVYHLENEVARLKKLIENKKA
DMKQLEDKVEELLSKVYHLENEVARLKKLVGER

Primary citation

alpha / beta coiled coils. Hartmann, M.D., Mendler, C.T., Bassler, J. et al. Elife (2016) 5. DOI 10.7554/eLife.11861 · PubMed

Other PDB entries of the same protein (UniProt P03069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AZD 0.98 Å, Crystal structure of tropomyosin N-terminal fragment at 0.98A resolution
2WQ1 1.08 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating bromide
2WQ0 1.12 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride
4OWI 1.2 Å, peptide structure
2WQ3 1.22 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride and nitrate
2HY6 1.25 Å, A seven-helix coiled coil
2WPZ 1.25 Å, GCN4 leucine zipper mutant with two VxxNxxx motifs coordinating chloride
6PSA 1.3 Å, PIE12 D-peptide against HIV entry (in complex with IQN17 Q577R resistance mutant)
2IPZ 1.35 Å, A Parallel Coiled-Coil Tetramer with Offset Helices
2YNY 1.35 Å, Salmonella enterica SadA 255-302 fused to GCN4 adaptors (SadAK1)
5APU 1.35 Å, Sequence IANKEDKAD inserted between GCN4 adaptors - Structure A9b black
2WQ2 1.36 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating iodide

Browse structure collections

About this viewer

MolViewer shows 5APS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.