5AWS: SGIP1 mu homology domain in the P1 space group

Crystal structure of the SGIP1 mu homology domain in the P1 space group. Determined by X-ray diffraction at 2.0 Å resolution. Released 6 Jul 2016.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,375
Mol. weight: 62.47 kDa
Ligands: ZN
Released: 6 Jul 2016

Explore 5AWS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5AWS contains 15 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	557-559	3
β-strand	560-575	16	1
α-helix	579-581	3
β-strand	583-595	13	1
α-helix	608-610	3
β-strand	612-616	5	2
α-helix	618-620	3
β-strand	621-626	6	1
β-strand	631-633	3	2
β-strand	643-647	5	2
α-helix	649-662	14
β-strand	668-678	11	1
α-helix	682-685	4
β-strand	688-696	9	3
β-strand	700-709	10	3
α-helix	711-713	3
β-strand	720-728	9	1
β-strand	733-740	8	3
β-strand	744-746	3	1
β-strand	751-759	9	1
β-strand	768-777	10	3
β-strand	787-794	8	1
β-strand	802-806	5	2
β-strand	810-827	18	1

Chain B: 8 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	559	1
β-strand	560-575	16	4
β-strand	578-595	18	4
α-helix	596-598	3
α-helix	608-610	3
β-strand	612-616	5	5
α-helix	618-620	3
β-strand	621-626	6	4
β-strand	631-633	3	5
β-strand	643-647	5	5
α-helix	649-662	14
β-strand	668-678	11	4
α-helix	682-685	4
β-strand	688-696	9	6
β-strand	700-709	10	6
α-helix	711-713	3
β-strand	720-728	9	4
β-strand	733-740	8	6
β-strand	744-746	3	4
β-strand	751-759	9	4
α-helix	764-767	4
β-strand	768-777	10	6
β-strand	787-794	8	4
β-strand	802-805	4	5
β-strand	810-827	18	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SH3-containing GRB2-like protein 3-interacting protein 1	A, B	protein	282	Homo sapiens	Q9BQI5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5AWS_1 SH3-containing GRB2-like protein 3-interacting protein 1 (chains A, B)
GPLGSLTMGAQDTLPVAAAFTETVNAYFKGADPSKCIVKITGEMVLSFPAGITRHFANNP
SPAALTFRVINFSRLEHVLPNPQLLCCDNTQNDANTKEFWVNMPNLMTHLKKVSEQKPQA
TYYNVDMLKYQVSAQGIQSTPLNLAVNWRCEPSSTDLRIDYKYNTDAMTTAVALNNVQFL
VPIDGGVTKLQAVLPPAVWNAEQQRILWKIPDISQKSENGGVGSLLARFQLSEGPSKPSP
LVVQFTSEGSTLSGCDIELVGAGYRFSLIKKRFAAGKYLADN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	12

Primary citation

Structural basis for the recognition of two consecutive mutually interacting DPF motifs by the SGIP1 mu homology domain. Shimada, A., Yamaguchi, A., Kohda, D. Sci Rep (2016) 6:19565-19565. DOI 10.1038/srep19565 · PubMed

Other PDB entries of the same protein (UniProt Q9BQI5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AWR 2.5 Å, Crystal structure of the SGIP1 mu homology domain in the P4212 space group
5AWU 2.7 Å, Crystal structure of the SGIP1 mu homology domain in complex with an Eps15 fragment…
6A9Y 2.7 Å, The crystal structure of Mu homology domain of SGIP1
5AWT 2.7 Å, Crystal structure of the SGIP1 mu homology domain in complex with an Eps15 fragment…

Browse structure collections

About this viewer

MolViewer shows 5AWS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.