6A9Y: Mu homology domain of SGIP1

Name: PDB 6A9Y: The crystal structure of Mu homology domain of SGIP1
Published: 2018-09-26
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: endocytosis

The crystal structure of Mu homology domain of SGIP1. Determined by X-ray diffraction at 2.7 Å resolution. Released 26 Sept 2018.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,260
Mol. weight: 31.27 kDa
Released: 26 Sept 2018

Explore 6A9Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6A9Y contains 7 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	549-555	7
β-strand	560-575	16	1
β-strand	583-595	13	1
α-helix	598-604	7
α-helix	608-611	4
β-strand	612-616	5	2
β-strand	624	1	1
β-strand	631-633	3	2
β-strand	642-647	6	2
α-helix	649-662	14
β-strand	668-677	10	1
α-helix	683-685	3
β-strand	688-696	9	3
β-strand	700-709	10	3
α-helix	711-713	3
β-strand	720-728	9	1
β-strand	735-740	6	3
β-strand	744-746	3	1
β-strand	751-759	9	1
α-helix	764-766	3
β-strand	768-776	9	3
β-strand	787-792	6	1
β-strand	802-805	4	2
β-strand	810-827	18	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SH3-containing GRB2-like protein 3-interacting protein 1	A	protein	284	Homo sapiens	Q9BQI5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6A9Y_1 SH3-containing GRB2-like protein 3-interacting protein 1 (chains A)
VDLGTENLYFQSADTLPVAAAFTETVNAYFKGADPSKCIVKITGEMVLSFPAGITRHFAN
NPSPAALTFRVINFSRLEHVLPNPQLLCCDNTQNDANTKEFWVNMPNLMTHLKKVSEQKP
QATYYNVDMLKYQVSAQGIQSTPLNLAVNWRCEPSSTDLRIDYKYNTDAMTTAVALNNVQ
FLVPIDGGVTKLQAVLPPAVWNAEQQRILWKIPDISQKSENGGVGSLLARFQLSEGPSKP
SPLVVQFTSEGSTLSGCDIELVGAGYRFSLIKKRFAAGKYLADN

Primary citation

SGIP1 dimerizes via intermolecular disulfide bond in mu HD domain during cellular endocytosis. Zhang, Y., Feng, Y., Xin, Y. et al. Biochem Biophys Res Commun (2018) 505:99-105. DOI 10.1016/j.bbrc.2018.09.075 · PubMed

Other PDB entries of the same protein (UniProt Q9BQI5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AWS 2.0 Å, Crystal structure of the SGIP1 mu homology domain in the P1 space group
5AWR 2.5 Å, Crystal structure of the SGIP1 mu homology domain in the P4212 space group
5AWU 2.7 Å, Crystal structure of the SGIP1 mu homology domain in complex with an Eps15 fragment…
5AWT 2.7 Å, Crystal structure of the SGIP1 mu homology domain in complex with an Eps15 fragment…

Browse structure collections

About this viewer

MolViewer shows 6A9Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.