5AWX: Human PTPRZ D1 domain

Crystal structure of Human PTPRZ D1 domain. Determined by X-ray diffraction at 1.86 Å resolution. Released 17 Feb 2016.

Method: X-ray diffraction
Resolution: 1.86 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,540
Mol. weight: 34.27 kDa
Released: 17 Feb 2016

Explore 5AWX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5AWX contains 14 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	1697-1698	2
β-strand	1699-1700	2	1
α-helix	1701-1703	3
α-helix	1704-1713	10
α-helix	1717-1733	10
α-helix	1748-1753	6
β-strand	1766-1768	3	2
α-helix	1769-1771	3
β-strand	1782-1790	9	2
β-strand	1793-1800	8	2
α-helix	1801-1804	4
α-helix	1805-1807	3
α-helix	1808-1817	10
β-strand	1822-1825	4	2
β-strand	1830-1831	2	3
β-strand	1834-1835	2	3
β-strand	1846-1849	4	2
β-strand	1852-1861	10	2
β-strand	1865-1874	10	2
β-strand	1889-1896	8	2
α-helix	1908-1921	14
α-helix	1928	1
β-strand	1929-1932	4	2
α-helix	1938-1956	19
β-strand	1958-1959	2	1
α-helix	1961-1968	8
α-helix	1979-1994	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor-type tyrosine-protein phosphatase zeta	A	protein	298	Homo sapiens	P23471 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5AWX_1 Receptor-type tyrosine-protein phosphatase zeta (chains A)
GPAIPIKHFPKHVADLHASSGFTEEFEEVQSCTVDLGITADSSNHPDNKHKNRYINIVAY
DHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNVEV
IVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQVLAYYTVRNFTLRNTKIKKGSQ
KGRPSGRVVTQYHYTQWPDMGVPEYSLPVLTFVRKAAYAKRHAVGPVVVHCSAGVGRTGT
YIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEV

Primary citation

Small-molecule inhibition of PTPRZ reduces tumor growth in a rat model of glioblastoma. Fujikawa, A., Nagahira, A., Sugawara, H. et al. Sci Rep (2016) 6:20473-20473. DOI 10.1038/srep20473 · PubMed

Other PDB entries of the same protein (UniProt P23471 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FN9 1.8 Å, Crystal structure of the C-terminal Fg domain of TNR with the single FN domain of PTPRZ
8FN8 1.89 Å, Crystal structure of the C-terminal Fg domain of TNC with the single FN domain of PTPRZ
3JXF 2.0 Å, CA-like domain of human PTPRZ
3S97 2.3 Å, PTPRZ CNTN1 complex
5H08 2.53 Å, Human PTPRZ D1 domain complexed with NAZ2329

Browse structure collections

About this viewer

MolViewer shows 5AWX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.