5B78: MOZ double PHD finger mutant-S210D/N235R

Crystal structure of MOZ double PHD finger mutant-S210D/N235R in complex with histone H3 crotonylation at K14. Determined by X-ray diffraction at 1.4 Å resolution. Released 26 Oct 2016.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,359
Mol. weight: 17.96 kDa
Ligands: ZN
Released: 26 Oct 2016

Explore 5B78 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5B78 contains 10 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	195-197	3
α-helix	203-206	4
β-strand	209	1	1
β-strand	228-229	2	1
β-strand	236-237	2	1
α-helix	239-242	4
α-helix	246-252	7
β-strand	265	1	2
α-helix	275-277	3
β-strand	279-280	2	2
β-strand	287-288	2	2
α-helix	290-292	3
α-helix	300-302	3

Chain B: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-3	2	2
α-helix	4-11	8
α-helix	14-16	3
α-helix	17-19	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone acetyltransferase KAT6A	A	protein	131	Homo sapiens	Q92794 (AlphaFold model)
Histone H3	B	protein	25	Homo sapiens	K7EMV3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5B78_1 Histone acetyltransferase KAT6A (chains A)
SLPHEKDKPVAEPIPICDFCLGTKEQNREKKPEELISCADCGRSGHPSCLKFSPELTVRV
KALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRP
RKKGRKLLQKK

Sequence of entity 2 (B), FASTA

>5B78_2 Histone H3 (chains B)
ARTKQTARKSTGGXAPRKQLATKAA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2. Xiong, X., Panchenko, T., Yang, S. et al. Nat Chem Biol (2016) 12:1111-1118. DOI 10.1038/nchembio.2218 · PubMed

Other PDB entries of the same protein (UniProt Q92794 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3V43 1.47 Å, Crystal structure of MOZ
7Y43 1.5 Å, Crystal structure of the KAT6A WH domain and its bound double stranded DNA
5B77 1.55 Å, Crystal structrue of MOZ double PHD finger in complex with histone H3 propionylation at…
4LK9 1.6 Å, Crystal Structure of MOZ double PHD finger histone H3 tail complex
4LKA 1.61 Å, Crystal Structure of MOZ double PHD finger histone H3K9ac complex
5B76 1.65 Å, Crystal structure of MOZ double PHD finger domain in complex with histone H3…
5B75 1.7 Å, Crystal structure of MOZ double PHD finger in complex with histone H3 butyrylation at K14
9DZN 1.72 Å, KAT6A MYST domain complexed with a H3K14-CoA bisubstrate inhibitor
8H7A 1.92 Å, Crystal structure of the dimer form KAT6A WH domain with its bound double stranded DNA
6LSB 2.0 Å, Crystal Structure of DPF domain of MOZ in complex with H3K14bz peptide
9ARR 2.1 Å, Crystal structure of AF9 YEATS domain in complex with dicrotonylated at K1007 and K1014…
29UQ 2.13 Å, KAT6A surface mutant in complex with co-factor acetyl-co-a

Browse structure collections

About this viewer

MolViewer shows 5B78 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.