5BU4: Ribonuclease T1 complex with 2'GMP

Ribonuclease T1 complex with 2'GMP. Determined by X-ray diffraction at 1.77 Å resolution. Released 23 Sept 1998.

Method: X-ray diffraction
Resolution: 1.77 Å
Organism: Aspergillus oryzae
Chains: 1
Atoms: 903
Mol. weight: 11.5 kDa
Ligands: 2GP, CA
Released: 23 Sept 1998

Explore 5BU4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5BU4 contains 4 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
β-strand	9-11	3	1
α-helix	13-29	17
β-strand	33	1	2
β-strand	38	1	2
β-strand	40-42	3	3
α-helix	53	1
α-helix	55	1
β-strand	56-60	5	3
α-helix	66-68	3
β-strand	76-81	6	3
β-strand	86-91	6	3
β-strand	101-102	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (ribonuclease T1)	A	protein	104	Aspergillus oryzae	P00651 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5BU4_1 PROTEIN (RIBONUCLEASE T1) (chains A)
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWP
ILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT

Ligands and cofactors

ID	Name	Formula	Copies
2GP	Guanosine-2'-monophosphate	C10 H14 N5 O8 P	1
CA	Calcium ion	Ca	1

Primary citation

Conserved water molecules in a large family of microbial ribonucleases. Loris, R., Langhorst, U., De Vos, S. et al. Proteins (1999) 36:117-134. DOI 10.1002/(SICI)1097-0134(19990701)36:1<117::AID-PROT10>3.0.CO;2-H · PubMed

Other PDB entries of the same protein (UniProt P00651 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1I0V 1.23 Å, Ribonuclease T1 in complex with 2'GMP (form I crystal)
4ODK 1.4 Å, Structure of SlyD from Thermus thermophilus in complex with T1 peptide
9RNT 1.5 Å, Ribonuclease T1 with free recognition and catalytic site: crystal structure analysis at…
1LOV 1.55 Å, X-ray structure of the E58A mutant of Ribonuclease T1 complexed with 3'-guanosine…
1LOY 1.55 Å, X-ray structure of the H40A/E58A mutant of Ribonuclease T1 complexed with 3'-guanosine…
1I0X 1.65 Å, Ribonuclease T1 in complex with 2'GMP (form II crystal)
4GSP 1.65 Å, Ribonuclease T1 complexed with 2',3'-cgps + 3'-GMP, 7 days
1HYF 1.7 Å, Ribonuclease T1 V16A mutant in complex with SR2+
1Q9E 1.7 Å, RNase T1 variant with adenine specificity
1RGA 1.7 Å, Crystal structure of RNase T1 with 3'-GMP and guanosine: a product complex
4BIR 1.7 Å, Ribonuclease T1: free HIS92GLN mutant
1I3I 1.76 Å, Ribonuclease T1 V78T mutant

Browse structure collections

About this viewer

MolViewer shows 5BU4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.