Crystal structure of the murine cd44 hyaluronan binding domain complex with a small molecule. Determined by X-ray diffraction at 1.15 Å resolution. Released 29 Jun 2016.
Explore 5BZR in 3D Show helices and sheets RCSB PDB PDBe
5BZR contains 8 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 25-30 | 6 | 1 |
| α-helix | 31-32 | 2 | |
| β-strand | 33-34 | 2 | 1 |
| β-strand | 37-42 | 6 | 1 |
| β-strand | 48 | 1 | 2 |
| α-helix | 50-59 | 10 | |
| β-strand | 63 | 1 | 1 |
| α-helix | 64-66 | 3 | |
| α-helix | 67-75 | 9 | |
| β-strand | 84-85 | 2 | 1 |
| β-strand | 90-94 | 5 | 1 |
| β-strand | 98 | 1 | 3 |
| β-strand | 101 | 1 | 3 |
| α-helix | 102-104 | 3 | |
| β-strand | 107-110 | 4 | 1 |
| α-helix | 111 | 1 | |
| β-strand | 119 | 1 | 2 |
| β-strand | 120-124 | 5 | 1 |
| β-strand | 132-133 | 2 | 1 |
| α-helix | 136-137 | 2 | |
| β-strand | 144-154 | 11 | 1 |
| β-strand | 159-165 | 7 | 1 |
| α-helix | 170-172 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CD44 antigen | A | protein | 151 | Mus musculus | P15379 (AlphaFold model) |
>5BZR_1 CD44 antigen (chains A) MNQIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCR YGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPN SFDGPVTITIVNRDGTRYSKKGEYRTHQEDI
| ID | Name | Formula | Copies |
|---|---|---|---|
| 4XM | 2-[3-(tetrahydro-2H-pyran-4-yloxy)propyl]-1,2,3,4-tetrahydroisoquinolin-8-amine | C17 H26 N2 O2 | 1 |
Water and common crystallization additives (DMS, GOL) are not listed.
Crystal structure of the murine cd44 hyaluronan binding domain complex with a small molecule. Liu, L.K., Finzel, B.C. To be published.
Other PDB entries of the same protein (UniProt P15379 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5BZR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.