5C79: PH domain of ASAP1

PH domain of ASAP1 in complex with diC4-PtdIns(4,5)P2. Determined by X-ray diffraction at 1.6 Å resolution. Released 7 Oct 2015.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,005
Mol. weight: 36.44 kDa
Ligands: PBU
Released: 7 Oct 2015

Explore 5C79 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5C79 contains 7 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	335-337	3
β-strand	342-349	8	1
β-strand	357-365	9	1
β-strand	368-371	4	1
α-helix	379-380	2
β-strand	381-384	4	1
α-helix	385-387	3
β-strand	389-392	4	1
β-strand	399-404	6	1
β-strand	407-412	6	1
α-helix	416-436	21

Chain B: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	342-349	8	2
β-strand	357-365	9	2
β-strand	368-371	4	2
α-helix	379-380	2
β-strand	381-384	4	2
α-helix	385-387	3
β-strand	389-392	4	2
β-strand	399-404	6	2
β-strand	407-412	6	2
α-helix	416-435	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Arf-GAP	A, B	protein	150	Mus musculus	Q9QWY8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5C79_1 Arf-GAP (chains A, B)
MGHHHHHHHHHHSSGHIDDDKHMGGYSMHQLQGNKEYGSEKKGFLLKKSDGIRKVWQRRK
CAVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYIA
WISVLTNSKEEALTMAFRGEQSTGENSLED

Ligands and cofactors

ID	Name	Formula	Copies
PBU	(2R)-3-{[(R)-HYDROXY{[(1R,2R,3S,4R,5R,6S)-2,3,6-trihydroxy-4,5-bis(phosphonooxy…	C17 H33 O19 P3	3

Water and common crystallization additives (CL) are not listed.

Primary citation

Molecular Basis for Cooperative Binding of Anionic Phospholipids to the PH Domain of the Arf GAP ASAP1. Jian, X., Tang, W.K., Zhai, P. et al. Structure (2015) 23:1977-1988. DOI 10.1016/j.str.2015.08.008 · PubMed

Other PDB entries of the same protein (UniProt Q9QWY8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8HLO 1.17 Å, Crystal structure of ASAP1-SH3 and MICAL1-PRM complex
5C6R 1.8 Å, Crystal structure of PH domain of ASAP1
8ZE8 2.07 Å, Arf-GTPase activating protein Asap1 SH3 domain in complex with 440 Kd Ankyrin-B fragment

Browse structure collections

About this viewer

MolViewer shows 5C79 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.