5CQC: Legionella pneumophila effector protein RavZ

Crystal structure of the legionella pneumophila effector protein RavZ. Determined by X-ray diffraction at 2.98 Å resolution. Released 9 Sept 2015.

Method: X-ray diffraction
Resolution: 2.98 Å
Organism: Legionella pneumophila
Chains: 1
Atoms: 2,608
Mol. weight: 47.26 kDa
Ligands: BA
Released: 9 Sept 2015

Explore 5CQC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CQC contains 15 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	50-51	2	1
α-helix	65-71	7
α-helix	72-76	5
β-strand	87-89	3	2
β-strand	99-104	6	2
β-strand	110-114	5	2
α-helix	115-116	2
β-strand	121-124	4	2
β-strand	127	1	3
β-strand	133-135	3	2
α-helix	137-152	16
β-strand	157-167	11	2
β-strand	176-185	10	2
β-strand	190-197	8	2
α-helix	210-215	6
β-strand	216	1	3
α-helix	221-231	11
β-strand	238-239	2	2
β-strand	243-246	4	2
α-helix	258-275	18
α-helix	295-307	13
β-strand	310-311	2	1
α-helix	312-321	10
α-helix	329-345	17
α-helix	359-377	19
α-helix	380-381	2
β-strand	382-383	2	4
α-helix	384-398	15
α-helix	400-411	12
α-helix	418-422	5
β-strand	426-427	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
putative RavZ protein	A	protein	420	Legionella pneumophila	Q5ZUV9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5CQC_1 putative RavZ protein (chains A)
GSKLIVDEFEELGEQELDKTTSIYPPETSWEVNKGMNSSRLHKLYSLFFDKSSAFYLGDD
VSVLEDKPLTGAYGFQSKKNDQQIFLFRPDSDYVAGYHVDAKSDAGWVNDKLDRRLSEIS
EFCSKATQPATFILPFVEMPTDITKGVQHQVLLTISYDPKSKQLTPTVYDSIGRDTYSES
LSSYFKGKYRTTCDEILTQSIEKAIKSTDFTLGKFTRAAYNHQNRLTEGNCGSYTFRTIK
EVISSSAQGTEVKIPGSGYITSNSYLTSQHVQDIESCIKYRNLGVVDIESALTEGKTLPV
QLSEFIVALEDYGKLRSQQSEKSMLNFIGYSKTAKLTAVELLIGILNDIKGKNEISESQY
DKLVKEVDCLMDSSLGKLVQFHLKNLGAESLQKLVLPCVKFDDELFDVPDITGEELASKK

Ligands and cofactors

ID	Name	Formula	Copies
BA	Barium ion	Ba	1

Primary citation

The Legionella Anti-autophagy Effector RavZ Targets the Autophagosome via PI3P- and Curvature-Sensing Motifs. Horenkamp, F.A., Kauffman, K.J., Kohler, L.J. et al. Dev Cell (2015) 34:569-576. DOI 10.1016/j.devcel.2015.08.010 · PubMed

Other PDB entries of the same protein (UniProt Q5ZUV9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MS5 1.53 Å, Low-salt structure of RavZ LIR2-fused human LC3B
5XAD 1.88 Å, NLIR - LC3B fusion protein
5MS2 2.47 Å, Crystal structure of the Legionella pneumophila effector protein RavZ in complex with…
5HZY 2.55 Å, Crystal structure of the legionella pneumophila effector protein RavZ - P6322
5IO3 2.74 Å, Crystal structure of the legionella pneumophila effector protein RavZ - I422
5MS7 2.8 Å, Crystal structure of the legionella pneumophila effector protein RavZ_20-502
5IZV 2.81 Å, Crystal structure of the legionella pneumophila effector protein RavZ - F222
5MS8 2.85 Å, Crystal structure of the legionella pneumophila effector protein RavZ_1-487

Browse structure collections

About this viewer

MolViewer shows 5CQC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.