5HZY: Uncharacterized protein RavZ

Crystal structure of the legionella pneumophila effector protein RavZ - P6322. Determined by X-ray diffraction at 2.55 Å resolution. Released 9 Nov 2016.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Legionella pneumophila subsp. pneumophila strain Philadelphia 1
Chains: 1
Atoms: 3,067
Mol. weight: 52.81 kDa
Released: 9 Nov 2016

Explore 5HZY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HZY contains 19 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	50-51	2	1
α-helix	59-61	3
α-helix	65-71	7
α-helix	72-76	5
β-strand	88-90	3	2
β-strand	99-104	6	2
β-strand	110-114	5	2
α-helix	115-116	2
β-strand	121-124	4	2
β-strand	127	1	3
β-strand	133-135	3	2
α-helix	137-151	15
β-strand	157-167	11	2
β-strand	176-185	10	2
β-strand	190-197	8	2
α-helix	212-214	3
β-strand	216	1	3
α-helix	221-232	12
β-strand	238-239	2	2
β-strand	243-246	4	2
α-helix	258-274	17
β-strand	281-282	2	4
β-strand	284-286	3	4
α-helix	289-292	4
α-helix	295-307	13
β-strand	310-311	2	1
α-helix	312-321	10
α-helix	326-328	3
α-helix	329-345	17
α-helix	359-377	19
β-strand	382-383	2	5
α-helix	384-397	14
α-helix	400-413	14
α-helix	418-422	5
α-helix	423-425	3
β-strand	426-427	2	5
α-helix	428	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uncharacterized protein RavZ	A	protein	469	Legionella pneumophila subsp. pneumophila strain Philadelphia 1	Q5ZUV9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5HZY_1 Uncharacterized protein RavZ (chains A)
MHHHHHHENLYFQGSSIYPPETSWEVNKGMNSSRLHKLYSLFFDKSSAFYLGDDVSVLED
KPLTGAYGFQSKKNDQQIFLFRPDSDYVAGYHVDAKSDAGWVNDKLDRRLSEISEFCSKA
TQPATFILPFVEMPTDITKGVQHQVLLTISYDPKSKQLTPTVYDSIGRDTYSESLSSYFK
GKYRTTCDEILTQSIEKAIKSTDFTLGKFTRAAYNHQNRLTEGNSGSYTFRTIKEVISSS
AQGTEVKIPGSGYITSNSYLTSQHVQDIESCIKYRNLGVVDIESALTEGKTLPVQLSEFI
VALEDYGKLRSQQSEKSMLNFIGYSKTAKLTAVELLIGILNDIKGKNEISESQYDKLVKE
VDCLMDSSLGKLVQFHLKNLGAESLQKLVLPCVKFDDTIDDFVTIEKDELFDVPDITGEE
LASKKGIEQGALDKEALLKQKQIKTDLLDLREEDKTGLKKPLHGGIKVK

Primary citation

The 1:2 complex between RavZ and LC3 reveals a mechanism for deconjugation of LC3 on the phagophore membrane. Kwon, D.H., Kim, S., Jung, Y.O. et al. Autophagy (2017) 13:70-81. DOI 10.1080/15548627.2016.1243199 · PubMed

Other PDB entries of the same protein (UniProt Q5ZUV9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MS5 1.53 Å, Low-salt structure of RavZ LIR2-fused human LC3B
5XAD 1.88 Å, NLIR - LC3B fusion protein
5MS2 2.47 Å, Crystal structure of the Legionella pneumophila effector protein RavZ in complex with…
5IO3 2.74 Å, Crystal structure of the legionella pneumophila effector protein RavZ - I422
5MS7 2.8 Å, Crystal structure of the legionella pneumophila effector protein RavZ_20-502
5IZV 2.81 Å, Crystal structure of the legionella pneumophila effector protein RavZ - F222
5MS8 2.85 Å, Crystal structure of the legionella pneumophila effector protein RavZ_1-487
5CQC 2.98 Å, Crystal structure of the legionella pneumophila effector protein RavZ

Browse structure collections

About this viewer

MolViewer shows 5HZY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.