5CQE: Matrix protein 1

2.1 Angstrom resolution crystal structure of matrix protein 1 (M1; residues 1-164) from Influenza A virus (A/Puerto Rico/8/34(H1N1)). Determined by X-ray diffraction at 2.1 Å resolution. Released 5 Aug 2015.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)
Chains: 2
Atoms: 2,636
Mol. weight: 42.3 kDa
Released: 5 Aug 2015

Explore 5CQE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CQE contains 21 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	3-12	10
α-helix	19-32	14
α-helix	39-47	9
α-helix	54-67	14
α-helix	74-77	4
α-helix	78-84	7
α-helix	90-103	14
α-helix	109-116	8
α-helix	121-132	12
α-helix	140-157	18

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	1-12	12
α-helix	19-32	14
α-helix	39-47	9
α-helix	54-67	14
α-helix	74-77	4
α-helix	78-83	6
α-helix	86-88	3
α-helix	90-103	14
α-helix	109-116	8
α-helix	121-132	12
α-helix	140-157	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Matrix protein 1	A, B	protein	188	Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)	P03485 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5CQE_1 Matrix protein 1 (chains A, B)
MHHHHHHSSGVDLGTENLYFQSNAMSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKN
TDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKA
VKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIAD
SQHRSHRQ

Primary citation

2.1 Angstrom resolution crystal structure of matrix protein 1 (M1; residues 1-164) from Influenza A virus (A/Puerto Rico/8/34(H1N1)). Halavaty, A.S., Minasov, G., Flores, K. et al. To be published.

Other PDB entries of the same protein (UniProt P03485 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VLL 1.6 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5TEZ 1.7 Å, TCR F50 recgonizing M1-HLA-A2
5ISZ 2.06 Å, Crystal structure of LS01-TCR/M1-HLA-A*02 complex
1AA7 2.08 Å, Influenza virus matrix protein crystal structure at PH 4.0
5EUO 2.1 Å, PF6-M1-HLA-A2
1EA3 2.3 Å, Influenza virus M1 protein
2VLR 2.3 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5JHD 2.46 Å, Crystal structure of LS10-TCR/M1-HLA-A*02 complex
1HHI 2.5 Å, The antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation…
3VDX 3.0 Å, Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains
7JM3 3.4 Å, Full-length three-dimensional structure of the influenza A virus M1 protein and its…
4IQ4 3.5 Å, Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains,…

Browse structure collections

About this viewer

MolViewer shows 5CQE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.