5CVB: Collagen alpha-1 chain,Collagen alpha-1 chain
Crystal structure of the type IX collagen NC2 hetero-trimerization domain with a guest fragment a1a1a1 of type I collagen. Determined by X-ray diffraction at 2.25 Å resolution. Released 10 Aug 2016.
- Method
- X-ray diffraction
- Resolution
- 2.25 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 2,786
- Mol. weight
- 42.53 kDa
- Released
- 10 Aug 2016
Explore 5CVB in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5CVB contains 23 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-8 | 6 | |
| α-helix | 13-40 | 28 | |
| α-helix | 41-54 | 14 | |
| α-helix | 56-61 | 6 | |
Chain B: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-8 | 5 | |
| α-helix | 10-40 | 31 | |
| α-helix | 42-60 | 19 | |
Chain C: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-8 | 7 | |
| α-helix | 10-40 | 31 | |
| α-helix | 41-63 | 23 | |
Chain D: 6 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-6 | 4 | |
| α-helix | 8-10 | 3 | |
| α-helix | 13-17 | 5 | |
| α-helix | 19-37 | 19 | |
| α-helix | 41-54 | 14 | |
| α-helix | 56-63 | 8 | |
Chain E: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10-12 | 3 | |
| α-helix | 14-38 | 25 | |
| α-helix | 42-56 | 15 | |
Chain F: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-9 | 6 | |
| α-helix | 11-13 | 3 | |
| α-helix | 18-40 | 23 | |
| α-helix | 41-64 | 24 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Collagen alpha-1(I) chain,Collagen alpha-1(IX) chain | A, D | protein | 71 | Homo sapiens | P02452 (AlphaFold model), P20849 (AlphaFold model) |
| Collagen alpha-1(I) chain,Collagen alpha-2(IX) chain | B, E | protein | 71 | Homo sapiens | P02452 (AlphaFold model), Q14055 (AlphaFold model) |
| Collagen alpha-1(I) chain,Collagen alpha-3(IX) chain | C, F | protein | 72 | Homo sapiens | P02452 (AlphaFold model), Q14050 (AlphaFold model) |
Sequence of entity 1 (A, D), FASTA
>5CVB_1 Collagen alpha-1(I) chain,Collagen alpha-1(IX) chain (chains A, D)
GSGPPGPPGPPGPPGARGQAGVMGFPGPPGPPGPPGRAPTDQHIKQVCMRVIQEHFAEMA
ASLKRPDSGAT
Sequence of entity 2 (B, E), FASTA
>5CVB_2 Collagen alpha-1(I) chain,Collagen alpha-2(IX) chain (chains B, E)
GSGPPGPPGPPGPPGARGQAGVMGFPGPPGPPGPPGRDATDQHIVDVALKMLQEQLAEVA
VSAKREALGAV
Sequence of entity 3 (C, F), FASTA
>5CVB_3 Collagen alpha-1(I) chain,Collagen alpha-3(IX) chain (chains C, F)
GSGPPGPPGPPGPPGARGQAGVMGFPGPPGPPGPPGKEASEQRIRELCGGMISEQIAQLA
AHLRKPLAPGSI
Primary citation
Structural insight for chain selection and stagger control in collagen. Boudko, S.P., Bachinger, H.P. Sci Rep (2016) 6:37831-37831. DOI 10.1038/srep37831 · PubMed
Other PDB entries of the same protein (UniProt P02452 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5CTD 1.6 Å, Crystal structure of the type IX collagen NC2 hetero-trimerization domain with a guest…
- 8YV3 1.68 Å, The heterotrimer structure of peptides derived from human collagen type I
- 1Q7D 1.8 Å, Structure of the integrin alpha2beta1 binding collagen peptide
- 5CTI 1.9 Å, Crystal structure of the type IX collagen NC2 hetero-trimerization domain with a guest…
- 5CVA 2.1 Å, Crystal structure of the type IX collagen NC2 hetero-trimerization domain with a guest…
- 3EJH 2.1 Å, Crystal Structure of the Fibronectin 8-9FnI Domain Pair in Complex with a Type-I…
- 5K31 2.2 Å, Crystal structure of Human fibrillar procollagen type I C-propeptide Homo-trimer
- 5OU8 2.5 Å, Crystal structure of Glycoprotein VI in complex with collagen-peptide (GPO)5
- 5OU9 2.5 Å, Crystal structure of Glycoprotein VI in complex with collagen-peptide (GPO)3
- 3GXE 2.6 Å, Complex of a Low Affinity Collagen Site with the Fibronectin 8-9FnI Domain Pair
- 7E7B 2.6 Å, Cryo-EM structure of the SARS-CoV-2 furin site mutant S-Trimer from a subunit vaccine…
- 7E7D 3.2 Å, Cryo-EM structure of the SARS-CoV-2 wild-type S-Trimer from a subunit vaccine candidate
Browse structure collections
About this viewer
MolViewer shows 5CVB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.