5D14: Interleukin-8

The atomic resolution crystal structure of human IL-8. Determined by X-ray diffraction at 1.0 Å resolution. Released 23 Dec 2015.

Method: X-ray diffraction
Resolution: 1.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 761
Mol. weight: 8.24 kDa
Released: 23 Dec 2015

Explore 5D14 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5D14 contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	17-19	3
β-strand	20-26	7	1
β-strand	29	1	2
β-strand	32	1	2
β-strand	36-41	6	1
β-strand	46-49	4	1
α-helix	54-68	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-8	A	protein	70	Homo sapiens	P10145 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5D14_1 Interleukin-8 (chains A)
KELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVV
EKFLKRAENS

Primary citation

The atomic resolution crystal structure of human IL-8. Brzezinski, K., Pompeu, Y., Lu, S. et al. To be published.

Other PDB entries of the same protein (UniProt P10145 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4XDX 0.95 Å, The crystal structure of soluble human interleukin 8 expressed in Pichia pastoris
6N2U 1.25 Å, IL-8 Structure from Bacterial Expression Source
3IL8 2.0 Å, Crystal structure of interleukin 8: symbiosis of NMR and crystallography
1ICW 2.01 Å, Interleukin-8, mutant with glu 38 replaced by cys and cys 50 replaced by ala
9YIP 2.2 Å, Crystal structure of human IL-8 in a large unit cell
6WZM 2.28 Å, LY3041658 Fab bound to CXCL8
1QE6 2.35 Å, Interleukin-8 with an added disulfide between residues 5 and 33 (L5C/H33C)
8XX6 2.99 Å, Structure of CXCR2 bound to CXCL8 (CXCR2-CXCL8-Go Full map)
8XWN 3.29 Å, Structure of CXCR2 bound to CXCL8 (Ligand-receptor focused map)
6LFO 3.4 Å, Cryo-EM structure of a class A GPCR monomer
8IC0 3.41 Å, Cryo-EM structure of CXCL8 bound C-X-C chemokine receptor 1 in complex with Gi…
6LFM 3.5 Å, Cryo-EM structure of a class A GPCR

Browse structure collections

About this viewer

MolViewer shows 5D14 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.