5DRV: G3BP2 NTF2-like domain

Crystal structure of the G3BP2 NTF2-like domain in complex with a peptide. Determined by X-ray diffraction at 2.75 Å resolution. Released 14 Oct 2015.

Method: X-ray diffraction
Resolution: 2.75 Å
Organisms: Homo sapiens, Semliki forest virus
Chains: 2
Atoms: 1,130
Mol. weight: 17.08 kDa
Released: 14 Oct 2015

Explore 5DRV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5DRV contains 6 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	8-25	18
α-helix	27-33	7
β-strand	34-43	10	1
β-strand	56	1	1
α-helix	58-66	9
β-strand	74-84	11	1
α-helix	86-88	3
β-strand	90-99	10	1
α-helix	103-105	3
β-strand	106-116	11	1
β-strand	123-133	11	1
α-helix	134-137	4

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-3	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras GTPase-activating protein-binding protein 2	A	protein	142	Homo sapiens	Q9UN86 (AlphaFold model)
Non-structural protein 3	B	protein	8	Semliki forest virus	P08411 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5DRV_1 Ras GTPase-activating protein-binding protein 2 (chains A)
GSHMVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYG
QNDIHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPE
GSVPNKFYVHNDMFRYEDEVFG

Sequence of entity 2 (B), FASTA

>5DRV_2 Non-structural protein 3 (chains B)
LTFGDFDE

Primary citation

Crystal structure of the G3BP2 NTF2-like domain in complex with a canonical FGDF motif peptide. Kristensen, O. Biochem Biophys Res Commun (2015) 467:53-57. DOI 10.1016/j.bbrc.2015.09.123 · PubMed

Other PDB entries of the same protein (UniProt Q9UN86 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OS2 2.5 Å, Cryo-EM structure of the DDB1/CRBN-MRT-5702-G3BP2 ternary complex

Browse structure collections

About this viewer

MolViewer shows 5DRV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.