5EA1: SMARCA4 bromodomain

Crystal Structure of SMARCA4 bromodomain in complex with MPD. Determined by X-ray diffraction at 2.0 Å resolution. Released 16 Mar 2016.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,244
Mol. weight: 47.19 kDa
Ligands: MRD
Released: 16 Mar 2016

Explore 5EA1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EA1 contains 27 α-helices and 6 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1453-1455	3
α-helix	1456-1471	16
β-strand	1473	1	1
β-strand	1480	1	1
α-helix	1483-1485	3
α-helix	1488-1490	3
α-helix	1495-1500	6
α-helix	1507-1515	9
α-helix	1522-1539	18
α-helix	1541	1
α-helix	1545-1564	20

Chain B: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1456-1471	16
β-strand	1473	1	2
β-strand	1480	1	2
α-helix	1483-1486	4
α-helix	1488-1490	3
α-helix	1495-1500	6
α-helix	1507-1515	9
α-helix	1522-1539	18
α-helix	1541	1
α-helix	1545-1566	22
α-helix	1571-1577	7

Chain C: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1452-1455	4
α-helix	1456-1471	16
β-strand	1473	1	3
β-strand	1480	1	3
α-helix	1483-1485	3
α-helix	1488-1490	3
α-helix	1495-1500	6
α-helix	1507-1515	9
α-helix	1522-1539	18
α-helix	1541	1
α-helix	1545-1565	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription activator BRG1	A, B, C	protein	132	Homo sapiens	P51532 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>5EA1_1 Transcription activator BRG1 (chains A, B, C)
SMLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFK
KIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKED
DSEGEESEEEEE

Ligands and cofactors

ID	Name	Formula	Copies
MRD	(4R)-2-methylpentane-2,4-diol	C6 H14 O2	3

Water and common crystallization additives (MPD) are not listed.

Primary citation

High-Throughput Fragment Docking into the BAZ2B Bromodomain: Efficient in Silico Screening for X-Ray Crystallography. Lolli, G., Caflisch, A. ACS Chem Biol (2016) 11:800-807. DOI 10.1021/acschembio.5b00914 · PubMed

Other PDB entries of the same protein (UniProt P51532 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7TAB 1.16 Å, G-925 bound to the SMARCA4 (BRG1) Bromodomain
2GRC 1.5 Å, 1.5 A structure of bromodomain from human BRG1 protein, a central ATPase of SWI/SNF…
6ZS2 1.57 Å, Crystal Structure of the bromodomain of human transcription activator BRG1 (SMARCA4) in…
7TD9 1.61 Å, G-059 bound to the SMARCA4 (BRG1) Bromodomain
6HR2 1.76 Å, Crystal structure of PROTAC 2 in complex with the bromodomain of human SMARCA4 and…
3UVD 1.85 Å, Crystal Structure of the bromodomain of human Transcription activator BRG1 (SMARCA4) in…
5DKD 2.0 Å, Crystal structure of the bromodomain of human BRG1 (SMARCA4) in complex with PFI-3…
9DTX 2.11 Å, Crystal structure of PRT3789 in complex with the bromodomain of human BRG1 (SMARCA4) and…
7VRB 2.39 Å, Structure of the Human BRG1/SS18 complex
9UXC 2.74 Å, The ADP-bound structure of BCL7B-containing ARP module of the human SWI/SNF complex
7VDT 2.8 Å, The motor-nucleosome module of human chromatin remodeling PBAF-nucleosome complex
9WBZ 2.9 Å, The structure of NCP-motor-ARP module of ncBAF-nucleosome complex

Browse structure collections

About this viewer

MolViewer shows 5EA1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.