7VRB: Human BRG1/SS18 complex

Structure of the Human BRG1/SS18 complex. Determined by X-ray diffraction at 2.39 Å resolution. Released 25 May 2022.

Method: X-ray diffraction
Resolution: 2.39 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,547
Mol. weight: 62.76 kDa
Released: 25 May 2022

Explore 7VRB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7VRB contains 21 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	5-22	18
α-helix	25-28	4
α-helix	29-34	6
α-helix	60-82	23
α-helix	86-111	26
α-helix	114-116	3

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	5-22	18
α-helix	29-34	6
α-helix	60-82	23
α-helix	88-111	24
α-helix	114-116	3

Chains C and D: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	5-22	18
α-helix	29-36	8
α-helix	60-82	23
α-helix	86-111	26
α-helix	114-116	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SMARCA4 protein,Protein SSXT	A, B, C, D	protein	143	Homo sapiens	P51532 (AlphaFold model), Q15532 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7VRB_1 SMARCA4 protein,Protein SSXT (chains A, B, C, D)
GSFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMGSENLYFQSGSGEITP
AAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAP
PTQNMPMGPGGMNQSGPPPPPRS

Primary citation

Phase transition and remodeling complex assembly are important for SS18-SSX oncogenic activity in synovial sarcomas. Cheng, Y., Shen, Z., Gao, Y. et al. Nat Commun (2022) 13:2724-2724. DOI 10.1038/s41467-022-30447-9 · PubMed

Other PDB entries of the same protein (UniProt P51532 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7TAB 1.16 Å, G-925 bound to the SMARCA4 (BRG1) Bromodomain
2GRC 1.5 Å, 1.5 A structure of bromodomain from human BRG1 protein, a central ATPase of SWI/SNF…
6ZS2 1.57 Å, Crystal Structure of the bromodomain of human transcription activator BRG1 (SMARCA4) in…
7TD9 1.61 Å, G-059 bound to the SMARCA4 (BRG1) Bromodomain
6HR2 1.76 Å, Crystal structure of PROTAC 2 in complex with the bromodomain of human SMARCA4 and…
3UVD 1.85 Å, Crystal Structure of the bromodomain of human Transcription activator BRG1 (SMARCA4) in…
5DKD 2.0 Å, Crystal structure of the bromodomain of human BRG1 (SMARCA4) in complex with PFI-3…
5EA1 2.0 Å, Crystal Structure of SMARCA4 bromodomain in complex with MPD
9DTX 2.11 Å, Crystal structure of PRT3789 in complex with the bromodomain of human BRG1 (SMARCA4) and…
9UXC 2.74 Å, The ADP-bound structure of BCL7B-containing ARP module of the human SWI/SNF complex
7VDT 2.8 Å, The motor-nucleosome module of human chromatin remodeling PBAF-nucleosome complex
9WBZ 2.9 Å, The structure of NCP-motor-ARP module of ncBAF-nucleosome complex

Browse structure collections

About this viewer

MolViewer shows 7VRB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.