The crystal structure of Human VPS34 in complex with a selective and potent inhibitor. Determined by X-ray diffraction at 2.7 Å resolution. Released 16 Nov 2016.
Explore 5ENN in 3D Show helices and sheets RCSB PDB PDBe
5ENN contains 64 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 294-301 | 8 | |
| α-helix | 310-318 | 9 | |
| α-helix | 320-322 | 3 | |
| α-helix | 327-329 | 3 | |
| α-helix | 330-336 | 7 | |
| α-helix | 342-354 | 13 | |
| α-helix | 357-359 | 3 | |
| α-helix | 360-363 | 4 | |
| α-helix | 364-367 | 4 | |
| α-helix | 374-384 | 11 | |
| α-helix | 389-402 | 14 | |
| α-helix | 403-405 | 3 | |
| α-helix | 408-413 | 6 | |
| α-helix | 475-483 | 9 | |
| α-helix | 487-502 | 16 | |
| α-helix | 504-509 | 6 | |
| α-helix | 511-530 | 20 | |
| α-helix | 533-560 | 28 | |
| α-helix | 566-578 | 13 | |
| β-strand | 591-593 | 3 | 1 |
| β-strand | 596-604 | 9 | 1 |
| β-strand | 610-611 | 2 | 1 |
| α-helix | 618 | 1 | |
| β-strand | 619-625 | 7 | 1 |
| β-strand | 630-637 | 8 | 1 |
| α-helix | 642-660 | 19 | |
| β-strand | 672-674 | 3 | 1 |
| β-strand | 679-683 | 5 | 1 |
| β-strand | 688-689 | 2 | 2 |
| α-helix | 690-696 | 7 | |
| α-helix | 700-707 | 8 | |
| β-strand | 709 | 1 | 3 |
| α-helix | 714-716 | 3 | |
| β-strand | 717 | 1 | 3 |
| α-helix | 719-738 | 20 | |
| β-strand | 749-751 | 3 | 2 |
| β-strand | 757-759 | 3 | 2 |
| α-helix | 781-787 | 7 | |
| α-helix | 793-811 | 19 | |
| α-helix | 813-821 | 9 | |
| α-helix | 829-832 | 4 | |
| α-helix | 835-837 | 3 | |
| α-helix | 838-846 | 9 | |
| α-helix | 852-867 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 291-301 | 11 | |
| α-helix | 306-309 | 4 | |
| α-helix | 310-318 | 9 | |
| α-helix | 320-323 | 4 | |
| α-helix | 330-336 | 7 | |
| α-helix | 342-354 | 13 | |
| α-helix | 357-359 | 3 | |
| α-helix | 360-363 | 4 | |
| α-helix | 364-367 | 4 | |
| α-helix | 374-384 | 11 | |
| α-helix | 389-402 | 14 | |
| α-helix | 403-405 | 3 | |
| α-helix | 408-413 | 6 | |
| α-helix | 475-483 | 9 | |
| α-helix | 487-502 | 16 | |
| α-helix | 504-509 | 6 | |
| α-helix | 511-530 | 20 | |
| α-helix | 533-560 | 28 | |
| α-helix | 566-578 | 13 | |
| β-strand | 591-593 | 3 | 4 |
| β-strand | 596-604 | 9 | 4 |
| β-strand | 610-611 | 2 | 4 |
| α-helix | 618 | 1 | |
| β-strand | 619-625 | 7 | 4 |
| β-strand | 630-637 | 8 | 4 |
| α-helix | 642-660 | 19 | |
| β-strand | 672-674 | 3 | 4 |
| β-strand | 679-683 | 5 | 4 |
| β-strand | 688-689 | 2 | 5 |
| α-helix | 690-696 | 7 | |
| α-helix | 700-707 | 8 | |
| β-strand | 709 | 1 | 6 |
| α-helix | 714-716 | 3 | |
| β-strand | 717 | 1 | 6 |
| α-helix | 719-738 | 20 | |
| β-strand | 749-751 | 3 | 5 |
| β-strand | 757-759 | 3 | 5 |
| α-helix | 781-787 | 7 | |
| α-helix | 793-811 | 19 | |
| α-helix | 813-821 | 9 | |
| α-helix | 829-832 | 4 | |
| α-helix | 835-837 | 3 | |
| α-helix | 838-846 | 9 | |
| α-helix | 852-869 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphatidylinositol 3-kinase catalytic subunit type 3 | A, B | protein | 625 | Homo sapiens | Q8NEB9 (AlphaFold model) |
>5ENN_1 Phosphatidylinositol 3-kinase catalytic subunit type 3 (chains A, B) MSYYHHHHHHDYDIPTTENLYFQGAMGSGIRDQLNIIVSYPPTKQLTYEEQDLVWKFRYY LTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVA RLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDS SQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECE DQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRE SGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLF FKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFM QFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVG DRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQC YTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSL IDESVHALFAAVVEQIHKFAQYWRK
| ID | Name | Formula | Copies |
|---|---|---|---|
| 5QS | 1-[[4-(cyclopropylmethyl)-5-[2-(pyridin-4-ylamino)pyrimidin-4-yl]pyrimidin-2-yl… | C21 H25 N7 O | 2 |
Water and common crystallization additives (SO4, GOL, NA) are not listed.
Potent, selective, and orally bioavailable inhibitors of VPS34 provide chemical tools to modulate autophagy in vivo. Kearney, E.P. To be published.
Other PDB entries of the same protein (UniProt Q8NEB9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5ENN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.