Small-molecule stabilization of the 14-3-3/Gab2 PPI interface. Determined by X-ray diffraction at 2.34 Å resolution. Released 4 May 2016.
Explore 5EWZ in 3D Show helices and sheets RCSB PDB PDBe
5EWZ contains 23 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-31 | 13 | |
| α-helix | 35-37 | 3 | |
| α-helix | 38-68 | 31 | |
| α-helix | 73-100 | 28 | |
| α-helix | 101-105 | 5 | |
| α-helix | 112-131 | 20 | |
| α-helix | 138-159 | 22 | |
| α-helix | 165-180 | 16 | |
| α-helix | 185-200 | 16 | |
| α-helix | 211-229 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-31 | 13 | |
| α-helix | 38-67 | 30 | |
| α-helix | 74-100 | 27 | |
| α-helix | 101-105 | 5 | |
| α-helix | 112-131 | 20 | |
| α-helix | 138-159 | 22 | |
| α-helix | 165-180 | 16 | |
| α-helix | 185-200 | 16 | |
| α-helix | 203-205 | 3 | |
| α-helix | 213-229 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 388-390 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 14-3-3 protein zeta/delta | A, B | protein | 230 | Homo sapiens | P63104 (AlphaFold model) |
| GRB2-associated-binding protein 2 | C | protein | 9 | Homo sapiens | Q9UQC2 (AlphaFold model) |
| GRB2-associated-binding protein 2 | D | protein | 6 | Homo sapiens | Q9UQC2 (AlphaFold model) |
>5EWZ_1 14-3-3 protein zeta/delta (chains A, B) MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTS
>5EWZ_2 GRB2-associated-binding protein 2 (chains C) PRRNTLPAM
>5EWZ_3 GRB2-associated-binding protein 2 (chains D) RSASFS
| ID | Name | Formula | Copies |
|---|---|---|---|
| BEZ | Benzoic acid | C7 H6 O2 | 2 |
Small-Molecule Stabilization of the 14-3-3/Gab2 Protein-Protein Interaction (PPI) Interface. Bier, D., Bartel, M., Sies, K. et al. ChemMedChem (2016) 11:911-918. DOI 10.1002/cmdc.201500484 · PubMed
Other PDB entries of the same protein (UniProt P63104 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5EWZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.