6ZFG: 14-3-3 zeta chimera with 18E6 and fusicoccin

14-3-3 zeta chimera with 18E6 and fusicoccin. Determined by X-ray diffraction at 1.85 Å resolution. Released 17 Feb 2021.

Method: X-ray diffraction
Resolution: 1.85 Å
Organisms: Homo sapiens, Human papillomavirus type 18
Chains: 2
Atoms: 4,588
Mol. weight: 56.24 kDa
Ligands: FSC
Released: 17 Feb 2021

Explore 6ZFG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ZFG contains 30 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-31	13
α-helix	35-37	3
α-helix	38-68	31
α-helix	73-100	28
α-helix	101-105	5
α-helix	106-108	3
α-helix	112-131	20
α-helix	137-159	23
α-helix	165-176	12
α-helix	177-181	5
α-helix	185-200	16
α-helix	203-206	4
α-helix	209-211	3
α-helix	212-228	17

Chain B: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-31	13
α-helix	35-37	3
α-helix	38-68	31
α-helix	73-100	28
α-helix	101-105	5
α-helix	112-131	20
α-helix	135-137	3
α-helix	138-159	22
α-helix	165-176	12
α-helix	177-181	5
α-helix	185-201	17
α-helix	203-205	3
α-helix	208-210	3
α-helix	211-228	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein zeta/delta,Protein E6	A, B	protein	243	Homo sapiens, Human papillomavirus type 18	P06463 (AlphaFold model), P63104 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6ZFG_1 14-3-3 protein zeta/delta,Protein E6 (chains A, B)
GPHMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRS
AWRVVSSIEQKTEGAAAAQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVF
YLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISAAAMQPTHPIRLGLALNFSVF
YYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTGGGGRRRE
TQV

Ligands and cofactors

ID	Name	Formula	Copies
FSC	Fusicoccin	C36 H56 O12	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Hierarchized phosphotarget binding by the seven human 14-3-3 isoforms. Gogl, G., Tugaeva, K.V., Eberling, P. et al. Nat Commun (2021) 12:1677-1677. DOI 10.1038/s41467-021-21908-8 · PubMed

Other PDB entries of the same protein (UniProt P06463 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JOR 1.34 Å, CFTR Associated Ligand (CAL) PDZ domain bound to HPV18 E6 oncoprotein C-terminal peptide…
5K4F 1.36 Å, CAL PDZ mutant C319A with a peptide
5IC3 1.7 Å, CAL PDZ domain with peptide and inhibitor
8OEP 1.87 Å, Crystal structure of the PTPN3 PDZ domain bound to the HPV18 E6 oncoprotein C-terminal…
6ZFD 1.9 Å, 14-3-3 zeta bound to the phosphorylated 18E6 C-terminus
6SJV 2.03 Å, Structure of HPV18 E6 oncoprotein in complex with mutant E6AP LxxLL motif
2I04 2.15 Å, X-ray crystal structure of MAGI-1 PDZ1 bound to the C-terminal peptide of HPV18 E6
2I0L 2.31 Å, X-ray crystal structure of Sap97 PDZ2 bound to the C-terminal peptide of HPV18 E6.
2I0I 2.8 Å, X-ray crystal structure of Sap97 PDZ3 bound to the C-terminal peptide of HPV18 E6
8B82 2.8 Å, Crystal structure of Scribble PDZ1 with human papillomavirus strain 16 E6 peptide

Browse structure collections

About this viewer

MolViewer shows 6ZFG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.