5EWZ: 14-3-3 protein zeta/delta

Small-molecule stabilization of the 14-3-3/Gab2 PPI interface. Determined by X-ray diffraction at 2.34 Å resolution. Released 4 May 2016.

Method: X-ray diffraction
Resolution: 2.34 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,031
Mol. weight: 54.75 kDa
Ligands: BEZ
Released: 4 May 2016

Explore 5EWZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EWZ contains 23 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-31	13
α-helix	35-37	3
α-helix	38-68	31
α-helix	73-100	28
α-helix	101-105	5
α-helix	112-131	20
α-helix	138-159	22
α-helix	165-180	16
α-helix	185-200	16
α-helix	211-229	19

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-31	13
α-helix	38-67	30
α-helix	74-100	27
α-helix	101-105	5
α-helix	112-131	20
α-helix	138-159	22
α-helix	165-180	16
α-helix	185-200	16
α-helix	203-205	3
α-helix	213-229	17

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	388-390	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein zeta/delta	A, B	protein	230	Homo sapiens	P63104 (AlphaFold model)
GRB2-associated-binding protein 2	C	protein	9	Homo sapiens	Q9UQC2 (AlphaFold model)
GRB2-associated-binding protein 2	D	protein	6	Homo sapiens	Q9UQC2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5EWZ_1 14-3-3 protein zeta/delta (chains A, B)
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTS

Sequence of entity 2 (C), FASTA

>5EWZ_2 GRB2-associated-binding protein 2 (chains C)
PRRNTLPAM

Sequence of entity 3 (D), FASTA

>5EWZ_3 GRB2-associated-binding protein 2 (chains D)
RSASFS

Ligands and cofactors

ID	Name	Formula	Copies
BEZ	Benzoic acid	C7 H6 O2	2

Primary citation

Small-Molecule Stabilization of the 14-3-3/Gab2 Protein-Protein Interaction (PPI) Interface. Bier, D., Bartel, M., Sies, K. et al. ChemMedChem (2016) 11:911-918. DOI 10.1002/cmdc.201500484 · PubMed

Other PDB entries of the same protein (UniProt P63104 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2O02 1.5 Å, Phosphorylation independent interactions between 14-3-3 and Exoenzyme S: from structure…
6F09 1.59 Å, Binary complex of 14-3-3 zeta with ubiquitin specific protease 8 (USP8) pSer718 peptide
7ZIT 1.79 Å, 14-3-3 in complex with SARS-COV2 N phospho-peptide
9UJ2 1.8 Å, 14-3-3 zeta chimera with the S202R peptide of SARS-CoV-2 N (residues 200-213)
6ZFG 1.85 Å, 14-3-3 zeta chimera with 18E6 and fusicoccin
6F08 1.9 Å, 14-3-3 zeta in complex with the human Son of sevenless homolog 1 (SOS1)
6ZFD 1.9 Å, 14-3-3 zeta bound to the phosphorylated 18E6 C-terminus
4FJ3 1.95 Å, 14-3-3 isoform zeta in complex with a diphoyphorylated C-RAF peptide
5EXA 1.95 Å, Small-molecule stabilization of the 14-3-3/Gab2 PPI interface
8P1H 1.95 Å, Crystal structure of the chimera of human 14-3-3 zeta and phosphorylated cytoplasmic…
8A9G 1.96 Å, Binary complex of 14-3-3 zeta Glucocorticoid Receptor (GR) pT524 peptide stabilised by…
1QJA 2.0 Å, 14-3-3 zeta/phosphopeptide complex (mode 2)

Browse structure collections

About this viewer

MolViewer shows 5EWZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.