5EYO: Max bHLH domain

The crystal structure of the Max bHLH domain in complex with 5-carboxyl cytosine DNA. Determined by X-ray diffraction at 2.39 Å resolution. Released 14 Dec 2016.

Method: X-ray diffraction
Resolution: 2.39 Å
Organisms: Homo sapiens, synthetic construct
Chains: 4
Atoms: 2,065
Mol. weight: 30.87 kDa
Released: 14 Dec 2016

Explore 5EYO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EYO contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	21-47	27
α-helix	60-102	43

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	21-49	29
α-helix	60-104	45

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein max	A, C	protein	88	Homo sapiens	P61244 (AlphaFold model)
DNA (5'-D(APGPTPAPGPCPAP(1CC)PGPTPGPCPTPAPCPT)-3')	B, D	DNA	16	synthetic construct

Sequence of entity 1 (A, C), FASTA

>5EYO_1 Protein max (chains A, C)
HMADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNH
THQQDIDDLKRQNALLEQQVRALEKARS

Sequence of entity 2 (B, D), FASTA

>5EYO_2 DNA (5'-D(*AP*GP*TP*AP*GP*CP*AP*(1CC)P*GP*TP*GP*CP*TP*AP*CP*T)-3') (chains B, D)
AGTAGCAXGTGCTACT

Primary citation

MAX is an epigenetic sensor of 5-carboxylcytosine and is altered in multiple myeloma. Wang, D., Hashimoto, H., Zhang, X. et al. Nucleic Acids Res (2017) 45:2396-2407. DOI 10.1093/nar/gkw1184 · PubMed

Other PDB entries of the same protein (UniProt P61244 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6G6K 1.35 Å, The crystal structures of Human MYC:MAX bHLHZip complex
1NKP 1.8 Å, Crystal structure of Myc-Max recognizing DNA
1NLW 2.0 Å, Crystal structure of Mad-Max recognizing DNA
6G6L 2.2 Å, The crystal structures of Human MYC:MAX bHLHZip complex
6G6J 2.25 Å, The crystal structures of Human MYC:MAX bHLHZip complex
7RCU 2.69 Å, Synthetic Max homodimer mimic in complex with DNA
1HLO 2.8 Å, The crystal structure of an intact human max-DNA complex: new insights into mechanisms…
1AN2 2.9 Å, Recognition by max of its cognate DNA through a dimeric b/hlh/z domain
8OTS 3.3 Å, OCT4 and MYC-MAX co-bound to a nucleosome
8OTT 3.3 Å, MYC-MAX bound to a nucleosome at SHL+5.8
1R05 Solution Structure of Max B-HLH-LZ

Browse structure collections

About this viewer

MolViewer shows 5EYO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.