5EZD: Kunitz-type protease inhibitor 1

Crystal structure of a Hepatocyte growth factor activator inhibitor-1 (HAI-1) fragment covering the PKD-like 'internal' domain and Kunitz domain 1. Determined by X-ray diffraction at 2.1 Å resolution. Released 18 May 2016.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,011
Mol. weight: 33.77 kDa
Released: 18 May 2016

Explore 5EZD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EZD contains 7 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	169-173	5	1
β-strand	178-180	3	2
β-strand	190-194	5	1
β-strand	199-201	3	2
β-strand	209-211	3	2
β-strand	216-222	7	1
β-strand	234-240	7	1
α-helix	243-246	4
α-helix	247-251	5
α-helix	253-254	2
β-strand	263-269	7	3
β-strand	274-280	7	3
β-strand	290	1	3
α-helix	293-300	8

Chain B: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	169-173	5	4
β-strand	178-180	3	5
β-strand	190-194	5	4
β-strand	199-201	3	5
β-strand	209-211	3	5
β-strand	216-222	7	4
β-strand	234-240	7	4
α-helix	243-250	8
α-helix	253-254	2
β-strand	263-269	7	6
β-strand	274-280	7	6
β-strand	290	1	6
α-helix	293-300	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kunitz-type protease inhibitor 1	A, B	protein	145	Homo sapiens	O43278 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5EZD_1 Kunitz-type protease inhibitor 1 (chains A, B)
KRGIDLKVQPQEPLVLKDVENTDWRLLRGDTDVRVERKDPNQVELWGLKEGTYLFQLTVT
SSDHPEDTANVTVTVLSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLG
NKNNYLREEECILACRGVDHHHHHH

Primary citation

Crystal Structure of a Two-domain Fragment of Hepatocyte Growth Factor Activator Inhibitor-1: FUNCTIONAL INTERACTIONS BETWEEN THE KUNITZ-TYPE INHIBITOR DOMAIN-1 AND THE NEIGHBORING POLYCYSTIC KIDNEY DISEASE-LIKE DOMAIN. Hong, Z., De Meulemeester, L., Jacobi, A. et al. J Biol Chem (2016) 291:14340-14355. DOI 10.1074/jbc.M115.707240 · PubMed

Other PDB entries of the same protein (UniProt O43278 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ISO 2.01 Å, Crystal Structure of Matriptase in complex with its inhibitor HAI-1
4ISL 2.29 Å, Crystal Structure of the inactive Matriptase in complex with its inhibitor HAI-1
4ISN 2.45 Å, Crystal Structure of Matriptase in complex with its inhibitor HAI-1
1YC0 2.6 Å, short form HGFA with first Kunitz domain from HAI-1
5H7V 3.82 Å, Structure of full-length extracellular domain of HAI-1 at pH 4.6
2MSX The solution structure of the MANEC-type domain from Hepatocyte Growth Factor Inhibitor…

Browse structure collections

About this viewer

MolViewer shows 5EZD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.