The crystal structure of human Plasma Kallikrein in complex with its peptide inhibitor pkalin-2. Determined by X-ray diffraction at 1.75 Å resolution. Released 14 Dec 2016.
Explore 5F8T in 3D Show helices and sheets RCSB PDB PDBe
5F8T contains 10 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 1 |
| β-strand | 20-21 | 2 | 2 |
| β-strand | 30-36 | 7 | 3 |
| β-strand | 38B-48 | 11 | 3 |
| β-strand | 51-54 | 4 | 3 |
| α-helix | 56-59 | 4 | |
| α-helix | 62-65C | 3 | |
| β-strand | 65D-67 | 4 | 3 |
| β-strand | 72 | 1 | 4 |
| α-helix | 73-75 | 3 | |
| β-strand | 83 | 1 | 3 |
| β-strand | 85-90 | 6 | 3 |
| β-strand | 104-108 | 5 | 3 |
| α-helix | 111-114 | 4 | |
| β-strand | 115 | 1 | 5 |
| β-strand | 118 | 1 | 5 |
| α-helix | 120-121 | 2 | |
| β-strand | 122 | 1 | 2 |
| α-helix | 130-132 | 3 | |
| β-strand | 136-140 | 5 | 2 |
| β-strand | 154 | 1 | 4 |
| α-helix | 155 | 1 | |
| β-strand | 156-159 | 4 | 2 |
| β-strand | 162-163 | 2 | 2 |
| α-helix | 165-171 | 7 | |
| β-strand | 180-183 | 4 | 2 |
| β-strand | 189 | 1 | 1 |
| β-strand | 198-203 | 6 | 2 |
| β-strand | 208B-215 | 10 | 2 |
| β-strand | 226-230 | 5 | 2 |
| α-helix | 231-234 | 4 | |
| α-helix | 235-245 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Plasma kallikrein light chain | A | protein | 239 | Homo sapiens | P03952 (AlphaFold model) |
| Cys-pro-lys-arg-phe-M70-ala-leu-phe-cys | P | protein | 10 | synthetic construct |
>5F8T_1 Plasma kallikrein light chain (chains A) IVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSG ILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPISLPSKGDT STIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGG KDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSD
>5F8T_2 CYS-PRO-LYS-ARG-PHE-M70-ALA-LEU-PHE-CYS (chains P) CPKRFAALFC
| ID | Name | Formula | Copies |
|---|---|---|---|
| MRZ | piperidine-1-carboximidamide | C6 H13 N3 | 1 |
Water and common crystallization additives (SO4) are not listed.
The crystal structure of human Plasma Kallikrein in complex with its peptide inhibitor pkalin-2. Xu, M., Jiang, L., Xu, P. et al. To be published.
Other PDB entries of the same protein (UniProt P03952 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5F8T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.