Endonuclease inhibitor 1 bound to influenza strain H1N1 polymerase acidic subunit N-terminal region at pH 7.0. Determined by X-ray diffraction at 2.51 Å resolution. Released 30 Dec 2015.
Explore 5FDD in 3D Show helices and sheets RCSB PDB PDBe
5FDD contains 10 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-5 | 4 | |
| α-helix | 6-13 | 8 | |
| α-helix | 16-28 | 13 | |
| α-helix | 37-55 | 19 | |
| β-strand | 61-63 | 3 | 1 |
| β-strand | 65 | 1 | 2 |
| β-strand | 67 | 1 | 2 |
| α-helix | 69-83 | 15 | |
| α-helix | 85-88 | 4 | |
| β-strand | 94-96 | 3 | 1 |
| β-strand | 101-108 | 8 | 1 |
| α-helix | 112-123 | 12 | |
| β-strand | 129-134 | 6 | 1 |
| β-strand | 139-141 | 3 | 1 |
| α-helix | 142-144 | 3 | |
| α-helix | 150-170 | 21 | |
| α-helix | 173-178 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polymerase acidic protein,Polymerase acidic protein | A | protein | 191 | Influenza A virus | P03433 (AlphaFold model) |
>5FDD_1 Polymerase acidic protein,Polymerase acidic protein (chains A) GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHR FEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKA NKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSE RGAAELALVPR
| ID | Name | Formula | Copies |
|---|---|---|---|
| 4P8 | 5-(2-chlorobenzyl)-2-hydroxy-3-nitrobenzaldehyde | C14 H10 Cl N O4 | 1 |
| MN | Manganese (II) ion | Mn | 1 |
Water and common crystallization additives (SO4) are not listed.
Two Distinctive Binding Modes of Endonuclease Inhibitors to the N-Terminal Region of Influenza Virus Polymerase Acidic Subunit. Fudo, S., Yamamoto, N., Nukaga, M. et al. Biochemistry (2016) 55:2646-2660. DOI 10.1021/acs.biochem.5b01087 · PubMed
Other PDB entries of the same protein (UniProt P03433 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5FDD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.