Crystal structure of influenza polymerase acidic subunit N-terminal domain crystallized by ammonium sulfate with glycan. Determined by X-ray diffraction at 1.6 Å resolution. Released 20 Apr 2022.
Explore 7XGC in 3D Show helices and sheets RCSB PDB PDBe
7XGC contains 9 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-13 | 8 | |
| α-helix | 16-28 | 13 | |
| α-helix | 37-55 | 19 | |
| β-strand | 61-63 | 3 | 1 |
| α-helix | 69-83 | 15 | |
| α-helix | 85-88 | 4 | |
| β-strand | 94-96 | 3 | 1 |
| β-strand | 101-108 | 8 | 1 |
| α-helix | 112-123 | 12 | |
| β-strand | 129-134 | 6 | 1 |
| β-strand | 139-141 | 3 | 1 |
| α-helix | 142-144 | 3 | |
| α-helix | 150-169 | 20 | |
| α-helix | 173-178 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polymerase acidic protein | A | protein | 191 | Influenza A virus (A/Puerto Rico/8/1934(H1N1)) | P03433 (AlphaFold model) |
>7XGC_1 Polymerase acidic protein (chains A) GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHR FEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKA NKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSE RGAAELALVPR
| ID | Name | Formula | Copies |
|---|---|---|---|
| MN | Manganese (II) ion | Mn | 2 |
Water and common crystallization additives (SO4) are not listed.
Influence of Glycan Agents on Protein Crystallization with Ammonium Sulfate. Guo, Y., Hoshino, T. Cryst Growth Des (2022). DOI 10.1021/acs.cgd.2c00901
Other PDB entries of the same protein (UniProt P03433 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7XGC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.