Apo form of influenza strain H1N1 polymerase acidic subunit N-terminal region crystallized with potassium sodium tartrate. Determined by X-ray diffraction at 1.75 Å resolution. Released 11 May 2016.
Explore 5JHT in 3D Show helices and sheets RCSB PDB PDBe
5JHT contains 9 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1-8 | 8 | |
| α-helix | 11-23 | 13 | |
| α-helix | 32-50 | 19 | |
| β-strand | 76-78 | 3 | 1 |
| α-helix | 84-98 | 15 | |
| α-helix | 100-103 | 4 | |
| β-strand | 109-111 | 3 | 1 |
| β-strand | 116-123 | 8 | 1 |
| α-helix | 127-138 | 12 | |
| β-strand | 144-149 | 6 | 1 |
| β-strand | 154-156 | 3 | 1 |
| α-helix | 157-159 | 3 | |
| α-helix | 165-184 | 20 | |
| α-helix | 188-194 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polymerase acidic protein | A | protein | 191 | Influenza A virus | P03433 (AlphaFold model) |
>5JHT_1 Polymerase acidic protein (chains A) GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHR FEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKA NKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSE RGAAELALVPR
Influence of Precipitants on Molecular Arrangements and Space Groups of Protein Crystals. Fudo, S., Fei, Q., Nukaga, M. et al. Cryst Growth Des (2017) 17:534-542. DOI 10.1021/acs.cgd.6b01385
Other PDB entries of the same protein (UniProt P03433 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5JHT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.